[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68675.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  18/68 : Bacteria  429/915 : Eukaryota  6/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:141 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   27->109 1z7uB PDBj 7e-14 47.5 %
:RPS:PDB   22->99 2d1hB PDBj 6e-08 15.6 %
:RPS:SCOP  11->121 1yyvA1  a.4.5.69 * 6e-28 32.4 %
:HMM:SCOP  13->136 2f2eA1 a.4.5.69 * 5e-29 35.2 %
:RPS:PFM   29->118 PF01638 * HxlR 6e-22 48.9 %
:HMM:PFM   29->116 PF01638 * HxlR 1.3e-32 45.5 88/91  
:BLT:SWISS 22->121 YTFH_SHIFL 3e-18 39.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68675.1 GT:GENE BAC68675.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1224632..1225057) GB:FROM 1224632 GB:TO 1225057 GB:DIRECTION - GB:PRODUCT putative transcriptional regulator GB:NOTE PF01638: Transcriptional regulator GB:PROTEIN_ID BAC68675.1 LENGTH 141 SQ:AASEQ MVTKQVRRAPEDKDVTRADSLAREIFSGVANKWALLIINVLGEQTLRFTEVRTAVDGISHKMLTQTLRGLERDGLVHRTVYAEVPPRVDYRLTEAGGALRDTVNGMCAWTRRYLDEIEAARRRFDAQHNDAAHPPHTGTKD GT:EXON 1|1-141:0| BL:SWS:NREP 1 BL:SWS:REP 22->121|YTFH_SHIFL|3e-18|39.0|100/126| BL:PDB:NREP 1 BL:PDB:REP 27->109|1z7uB|7e-14|47.5|80/106| RP:PDB:NREP 1 RP:PDB:REP 22->99|2d1hB|6e-08|15.6|77/96| RP:PFM:NREP 1 RP:PFM:REP 29->118|PF01638|6e-22|48.9|90/91|HxlR| HM:PFM:NREP 1 HM:PFM:REP 29->116|PF01638|1.3e-32|45.5|88/91|HxlR| RP:SCP:NREP 1 RP:SCP:REP 11->121|1yyvA1|6e-28|32.4|111/114|a.4.5.69| HM:SCP:REP 13->136|2f2eA1|5e-29|35.2|122/0|a.4.5.69|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 1053 OP:NHOMOORG 453 OP:PATTERN 11-----------11---------311211----1----1---68--2--221--------------- 2---9--2222---1----------5-------1115242-A5C22-1-11-311--2--211-7-4886--111-11--121-1---1211-12------5---K36-1----------------------------------111-1322---111-----11-11211---------------11--12-699999A5935A8789467777818--15-533222229G-------1--11---1---22-3--------43----322-1-222---1-----1------------1111-1111111-11---11111--8E2223222141-3111---21----1---231------1---2-212-1122------43444--13212-----------2-23142327161-9664751457235121--131--1--111111111-324---2-----------------------------1-2112-----334262122221131222222323--3-----31-1--11-11--2--1112------------1-111-1111-31111-11---11111---21-12-11-1-11-1-1--------1---111--1---------------------------------------2136-3-1111111111-111111111111111111112164--11111--1---11111121111111--211111111111---------1111--422---211-----1--144545-2----1----1113------123------------------------32131321111111---1----------------1----1-------------------------------12 --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1------3--------------1--1-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 114 STR:RPRED 80.9 SQ:SECSTR ##########cccccTTHHHHHHHHHHTccHHHHHHHHHHHHTccccHHHHHHHHHTccHHHHHHHHHHHHHTTcEEEEEcccEEEEEcTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHH################# DISOP:02AL 1-14, 130-141| PSIPRED ccccHHcccccccccccccccHHHHHHHHHcHHHHHHHHHHccccccHHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEccccccEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccc //