[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68680.1
DDBJ      :             putative simple sugar ABC transporter ATP-binding protein
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  900/915 : Eukaryota  165/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:522 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   9->229 1g6hA PDBj 4e-22 28.5 %
:BLT:PDB   270->484 1l2tB PDBj 2e-14 26.2 %
:RPS:PDB   4->498 3cmvC PDBj 8e-36 8.4 %
:RPS:SCOP  6->230 1ji0A  c.37.1.12 * 1e-33 24.9 %
:RPS:SCOP  271->498 1b0uA  c.37.1.12 * 2e-25 22.8 %
:HMM:SCOP  13->233 1ii8.1 c.37.1.12 * 1.4e-61 35.6 %
:HMM:SCOP  267->512 1g6hA_ c.37.1.12 * 2.3e-50 35.1 %
:RPS:PFM   50->176 PF00005 * ABC_tran 6e-05 24.4 %
:RPS:PFM   355->436 PF00005 * ABC_tran 4e-08 39.7 %
:HMM:PFM   50->176 PF00005 * ABC_tran 7.7e-19 29.9 117/118  
:HMM:PFM   309->436 PF00005 * ABC_tran 1.8e-18 33.0 112/118  
:HMM:PFM   25->67 PF03193 * DUF258 6e-06 31.0 42/161  
:BLT:SWISS 10->502 RBSA_GEOKA e-108 43.4 %
:PROS 409->423|PS00211|ABC_TRANSPORTER_1
:REPEAT 2|10->223|270->484
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68680.1 GT:GENE BAC68680.1 GT:PRODUCT putative simple sugar ABC transporter ATP-binding protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1229709..1231277) GB:FROM 1229709 GB:TO 1231277 GB:DIRECTION - GB:PRODUCT putative simple sugar ABC transporter ATP-binding protein GB:NOTE PF00005: ABC transporter GB:PROTEIN_ID BAC68680.1 LENGTH 522 SQ:AASEQ MTASPVSAEVLAVRGLTKRFPGVTALDDVDFSVRAGEVHALVGENGAGKSTLIKVLTGVHRADEGGVFHRGEPVAFGTPLEAQHAGISTIYQEVNLIPLMSVARNLFLGREPRTRLGLIDFRRMHTEAHQVLTAYGVDVDVRRPLRQLGVGAQQMVALARAVAVDASVVVMDEPTSSLEPREVHTLFGVIRRLRDQGIAVVYVSHRMEELYAVCDSVTVLRDGHHVHTGPLAGTDRLTLVSYMLGRDLGEVRSEGTTKFSGTHDTGGEPVLRAENLTRPHQLRAVSLEIHPGEVLGLGGLLGSGRSETAKAVAGALALADGRVTVAGVPVRTGSTVAAIRAGISLLPEDRKSEGIVPGLSVRENIALAALPQLSRYGLVAESRMDAVVDTFMKRLRIKASSPHQKVGELSGGNQQKVLLARWLAMNPKVLLLDEPTRGIDIGAKAEVQQLIDELAEDGLGVLLISSDIEELIEGSDRVVVLRDGAAIAELRADDVTADRLMRAIAQAAEEEASTEEEAATHG GT:EXON 1|1-522:0| BL:SWS:NREP 1 BL:SWS:REP 10->502|RBSA_GEOKA|e-108|43.4|486/494| PROS 409->423|PS00211|ABC_TRANSPORTER_1|PDOC00185| NREPEAT 1 REPEAT 2|10->223|270->484| SEG 156->170|valaravavdasvvv| SEG 295->302|lglggllg| SEG 309->319|akavagalala| SEG 503->519|aiaqaaeeeasteeeaa| BL:PDB:NREP 2 BL:PDB:REP 9->229|1g6hA|4e-22|28.5|221/254| BL:PDB:REP 270->484|1l2tB|2e-14|26.2|210/232| RP:PDB:NREP 1 RP:PDB:REP 4->498|3cmvC|8e-36|8.4|464/1175| RP:PFM:NREP 2 RP:PFM:REP 50->176|PF00005|6e-05|24.4|123/123|ABC_tran| RP:PFM:REP 355->436|PF00005|4e-08|39.7|78/123|ABC_tran| HM:PFM:NREP 3 HM:PFM:REP 50->176|PF00005|7.7e-19|29.9|117/118|ABC_tran| HM:PFM:REP 309->436|PF00005|1.8e-18|33.0|112/118|ABC_tran| HM:PFM:REP 25->67|PF03193|6e-06|31.0|42/161|DUF258| GO:PFM:NREP 4 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 2 RP:SCP:REP 6->230|1ji0A|1e-33|24.9|221/240|c.37.1.12| RP:SCP:REP 271->498|1b0uA|2e-25|22.8|224/258|c.37.1.12| HM:SCP:REP 13->233|1ii8.1|1.4e-61|35.6|219/370|c.37.1.12|1/2|P-loop containing nucleoside triphosphate hydrolases| HM:SCP:REP 267->512|1g6hA_|2.3e-50|35.1|242/254|c.37.1.12|2/2|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 31291 OP:NHOMOORG 1133 OP:PATTERN MMA6HJA5LJIFKHNBYAKIJJKOrNRZeQdUC599B7BBB88INDQWDGsfT7HKDHLEG8C6Q155 HJUG*MMSZabOMLKIGGG-GY55P*GFGGGFgdden***M*R*f*hWWaQGvqjJGS77kmvO*hv***VOJJJjOMKHjMi65659EDC82C785--8AF8BBPCKAD35555555442222CLJAFG7BHFNCcdcljBBClWcMUaKLSVcLOGAEADDTONWeeZG9E89788G6777bVQQLXQ5OTauvvsvsz*kzywst*tfeecjzy*QchsqOaYYYWXX**IKKLNLJHJJKKKIIIGFIFTGLIhfGKHDKYWFGdiIIDGNJNRRVVXaVPWVYXZZXZWXXZYZYRQQQPRSTTTTQRaZYQQQZYaVVkedadeddccdIcKWZXXKIJHyRUQI*STOF**SZUPUWMUQPPTGGKRFPMMMFBDBABWP***TIl****u**z**y*v***-gj*ea*e***M7**************ECFy*********GFGGGGGGxSUEKbRv554121111111-1123-2--1--14332C77A8Ax**x*******qkkmi****upssZw******z7JnpmvZlbh*y****QbXDKBFXLEEECDDDIGHOgdLtyIPOkVMXcPPdDOJPJMRQJPRTLRcnQr8AAE7999B9A556776666AH867BAVYm7ZHI8HAaEFFGGAFLEDDEFFKGGKH3-39LHJ-1-111sg**Mtghiidhgeice-gffegchfefhigacgbbc*****RQNYXVXWZYaYaWXaXXW*bZVabXdF1rwwx*zyrvz**22CA9A89ADBDDFDjXyPONQLODHJGGOKQRGHIGH9I9DEXPhhdgi*u*frsljW***A87577778CHNNZYZZaYXbXbcGJHIFIIFHG887822GGBB577844443444UAG63744-5533634987634643333MQYGITmTWS8PI ----A74-F83748812512643436333-111898-23222211132217594225133133----------2-------------2-111221-1122213773-465J5B4BAD53617B8IO2H2a*H2FAL783-F13IE46736D45u6F6AQ34G3L632C7GTEIA55323q34124A45O28573C4DB3 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 507-522| PSIPRED cccccccccEEEEEccEEEcccEEEEccccEEEcccEEEEEEccccccHHHHHHHHHccccccccEEEEEcEEcccccHHHHHHcccEEEEccHHHcccccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHcccccccccHHHccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHccEEEEEEccEEEEEccHHHccHHHHHHHHHHHHHHHHHccccccccccccccccEEEEEEEEEEccccccccEEEEccEEEEEEccccccHHHHHHHHHccccccccEEEEEEEEcccccHHHHHHcccEEEccccccccccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHccccccHHccHHHcccHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHccEEEEEEccEEEEEccHHHHcHHHHHHHHHcccHHHHcccccccccc //