[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68686.1
DDBJ      :             putative nucleotide-binding protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.82.3
:111 amino acids
:SECSTR
:PSIPRED
:RPS:PDB   2->107 1db9A PDBj 1e-14 18.9 %
:RPS:SCOP  2->107 1cgpA2  b.82.3.2 * 9e-14 18.9 %
:HMM:SCOP  1->108 1wgpA_ b.82.3.2 * 4.3e-15 27.8 %
:RPS:PFM   15->98 PF00027 * cNMP_binding 2e-05 28.9 %
:HMM:PFM   12->100 PF00027 * cNMP_binding 1.4e-16 25.0 88/91  
:BLT:SWISS 10->110 FNR_PASMU 1e-09 30.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68686.1 GT:GENE BAC68686.1 GT:PRODUCT putative nucleotide-binding protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1239936..1240271 GB:FROM 1239936 GB:TO 1240271 GB:DIRECTION + GB:PRODUCT putative nucleotide-binding protein GB:NOTE PF00027: Cyclic nucleotide-binding domain putative nucleotide-binding protein (truncated by insertion of ISSav4C) GB:PROTEIN_ID BAC68686.1 LENGTH 111 SQ:AASEQ MLKEIATRFRTREVRSGQVLFEAGQPVTEAYVIAHGRFTRYTAGKYGEEETIGVVTDGDQMGDEAIGQSDPLWLSSVRAETAGVVLVLPWDVVTEFTERVPSLAAHLVGLR GT:EXON 1|1-111:0| BL:SWS:NREP 1 BL:SWS:REP 10->110|FNR_PASMU|1e-09|30.6|98/273| RP:PDB:NREP 1 RP:PDB:REP 2->107|1db9A|1e-14|18.9|106/200| RP:PFM:NREP 1 RP:PFM:REP 15->98|PF00027|2e-05|28.9|83/90|cNMP_binding| HM:PFM:NREP 1 HM:PFM:REP 12->100|PF00027|1.4e-16|25.0|88/91|cNMP_binding| RP:SCP:NREP 1 RP:SCP:REP 2->107|1cgpA2|9e-14|18.9|106/129|b.82.3.2| HM:SCP:REP 1->108|1wgpA_|4.3e-15|27.8|108/0|b.82.3.2|1/1|cAMP-binding domain-like| OP:NHOMO 25 OP:NHOMOORG 12 OP:PATTERN -------------------------------------------------------------------- ----3------------------------------------111--------------------2-5222---------------------------------------------------------------------------------------------------2---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------22-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 108 STR:RPRED 97.3 SQ:SECSTR GHHHHHTTcEEEEEcTTcEEEcTTccccEEEEEEEccEEEEEEcTTccEEEEEEEcTTcEEccTTTTccccccccEEEEcccEEEEEEEHHHHHHHHHHcTHHHHHHH### PSIPRED cHHHHHHHHEEEEEccccEEEcccccccEEEEEEEEEEEEEEEcccccEEEEEEEccccEEEEEHHccccccEEEEEEEEEEEEEEEEEHHHHHHHHHHcHHHHHHHHHcc //