[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68687.2
DDBJ      :             putative IS701 family ISAzvi8-like transposase
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  63/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.43.1c.55.3
:424 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   125->404 1b7eA PDBj 1e-11 9.1 %
:RPS:SCOP  72->100 1c4tA  c.43.1.1 * 5e-04 27.6 %
:RPS:SCOP  137->404 1b7eA  c.55.3.4 * 1e-14 10.3 %
:HMM:SCOP  8->410 1musA_ c.55.3.4 * 3.8e-33 23.0 %
:RPS:PFM   39->142 PF03740 * PdxJ 5e-04 29.0 %
:RPS:PFM   343->395 PF01609 * Transposase_11 3e-04 37.7 %
:HMM:PFM   193->394 PF01609 * Transposase_11 9.4e-15 26.0 131/207  
:BLT:SWISS 39->225 T701_FREDI 3e-13 30.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68687.2 GT:GENE BAC68687.2 GT:PRODUCT putative IS701 family ISAzvi8-like transposase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1240310..1241584 GB:FROM 1240310 GB:TO 1241584 GB:DIRECTION + GB:PRODUCT putative IS701 family ISAzvi8-like transposase GB:NOTE IS701 family (1240250..1241683) Inverted repeat sequence (16/16 bp). Target sequence (CTAG); same as SAV289 and SAV319. GB:PROTEIN_ID BAC68687.2 LENGTH 424 SQ:AASEQ MDAHEVNRARATLALFVADVFASVPRKDQRAKGDCYLRGLMLDGRRKSIQPMAERLPDGNEQNLQQFVNQSTWDPVPVRRRIAERMVAQIGPDAWAVDDVSFPKDGKMSVAVAHQYCGALGKQANCQVAVSVHAVSDTASCPLQWRLFVPQEWAHDAPRRQKTGIPPEVGHREKWRLALDIFDELAGWGLVPPVVVADAGYGQNADFRDGLDGRGIGYVAAIRSDVTVHPHDAEPFAPPWSGNGRKPQPRYRDKPSSVAALATGHGRQAFTEVTWREGSRGPMRSHFLSLRVRPAGVKSRRLAQAAATDENCWDGVLPEVTLLVEWPEGAEAPTDYWLSNLPDTLSLAELVRLAKIRWRIEHDYRELKHGLGLDHFEGRSWTGWHHHVSLVTAAHAFLTEQRLAPKAGTADSPSTRPSTPSRTC GT:EXON 1|1-424:0| BL:SWS:NREP 1 BL:SWS:REP 39->225|T701_FREDI|3e-13|30.3|175/100| SEG 412->423|spstrpstpsrt| RP:PDB:NREP 1 RP:PDB:REP 125->404|1b7eA|1e-11|9.1|243/372| RP:PFM:NREP 2 RP:PFM:REP 39->142|PF03740|5e-04|29.0|100/237|PdxJ| RP:PFM:REP 343->395|PF01609|3e-04|37.7|53/192|Transposase_11| HM:PFM:NREP 1 HM:PFM:REP 193->394|PF01609|9.4e-15|26.0|131/207|Transposase_11| GO:PFM:NREP 5 GO:PFM GO:0005737|"GO:cytoplasm"|PF03740|IPR004569| GO:PFM GO:0008615|"GO:pyridoxine biosynthetic process"|PF03740|IPR004569| GO:PFM GO:0003677|"GO:DNA binding"|PF01609|IPR002559| GO:PFM GO:0004803|"GO:transposase activity"|PF01609|IPR002559| GO:PFM GO:0006313|"GO:transposition, DNA-mediated"|PF01609|IPR002559| RP:SCP:NREP 2 RP:SCP:REP 72->100|1c4tA|5e-04|27.6|29/226|c.43.1.1| RP:SCP:REP 137->404|1b7eA|1e-14|10.3|234/372|c.55.3.4| HM:SCP:REP 8->410|1musA_|3.8e-33|23.0|365/0|c.55.3.4|1/1|Ribonuclease H-like| OP:NHOMO 573 OP:NHOMOORG 66 OP:PATTERN ----------------------------1-1--------------------2---------------- --1----2--1---1-----------------------91--4E----------------13----68131---------------------------------------------------------------------------1---1-U-----------2-1--3-------------11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------A-----------4-13-------------------122---2--5--------1-----13-----1-------KJIJIIII225-11--------------------------------------------------------2--------1--------7---1--61----------------------2-----------------------6------62------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------4-------------------------------------------------***--------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 278 STR:RPRED 65.6 SQ:SECSTR ############################################################################################################################EEEcccccEEEEEEEEETTTcc###EEEEEEEEEEcccccGGGHHHHHTHHHHHHHHHHHHHGGGGGGEEEEEEEccc#HHHHHHHHHHHTcEEEEEEccccccTTcccTcccHHHHHHTccccEEEEHHHHHHHHHHHccHHEEEccccccccEEEEEEEcEEEEEccTTccEEEEEEHHHHHHHHTGGGccHEEEccccccccccEEEEEEccccccHHHHHHHHHHHHTcTHHHHHHHHHHHHHTTTcccccccHHHHHHHHHHHHHHHHHHHHHHHTc################## DISOP:02AL 1-3, 402-424| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccccHHHHHHHcccccHHHHHHHHccccccHHHHHHHHHHHHHHHccccEEEEEccccccccccccccccccccccccccccEEEEEEEEEEccEEEEEEEEEEccccccccHHHHHHcccccccccccHHHHHHHHHHHHHHccccccEEEEEccccccHHHHHHHHHccccEEEEcccccEEEccccccccccccccccccccccccccccHHHHHHHccccccEEEEEcccccccEEEEEEEEEEEEccccccEEEEccccccccccccccccEEEEEEcccccccccEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccc //