[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68691.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  72/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:205 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   50->102 PF02936 * COX4 0.0009 18.9 53/143  
:BLT:SWISS 4->151 SRPI_SYNE7 4e-37 52.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68691.1 GT:GENE BAC68691.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1244924..1245541 GB:FROM 1244924 GB:TO 1245541 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68691.1 LENGTH 205 SQ:AASEQ MNRKGEADVPVQAGHVGEPSLNGGFVDYDLAPREYELSLTQTVLRVHTRVADLYNEPMNQTEQQLRLTIEEIRERQEWELLNNREFGLLHNADYGQRISTFTGPPTPDDLDELLCMRRKTRLFLAHPKAIAAFFRQCNRRGLVPGTANIDGHELPAGAASRCSPAARSRSPRSTPAASSRCAPGRPTKASSASIRPASRRSTSPV GT:EXON 1|1-205:0| BL:SWS:NREP 1 BL:SWS:REP 4->151|SRPI_SYNE7|4e-37|52.0|148/306| SEG 155->183|pagaasrcspaarsrsprstpaassrcap| SEG 189->203|assasirpasrrsts| HM:PFM:NREP 1 HM:PFM:REP 50->102|PF02936|0.0009|18.9|53/143|COX4| OP:NHOMO 88 OP:NHOMOORG 72 OP:PATTERN -------------------------------------------------------------------- ----3---------111-----11-1---------------111--------------------2-5222-------------------------------1---111--------------------------------------------1---1------------2--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------11------111-1------------11-11-11-------------------------1------------------1--------------------------------------------111--1111----1111--1-2----------1---11--1--1--111---------1---1-----------------------------23--------------------------------------------------------------------------------------------------------------1----------------------1------------------------------------------------------11111-1---21------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 8-11, 160-205| PSIPRED cccccccHHEEEcccccccccccccccccccccEEEHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEccccccEEcccccccccccHHHHHHHHHccccEEEcHHHHHHHHHHHccccccccEEEcccccccccccHHcccHHHcccccccccccccccccccccccccccccccccccccc //