[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68692.1
DDBJ      :             putative nucleotide-binding protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:40 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   1->23 PF09834 * DUF2061 0.001 26.1 23/53  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68692.1 GT:GENE BAC68692.1 GT:PRODUCT putative nucleotide-binding protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1245553..1245675 GB:FROM 1245553 GB:TO 1245675 GB:DIRECTION + GB:PRODUCT putative nucleotide-binding protein GB:NOTE putative nucleotide-binding protein (truncated) GB:PROTEIN_ID BAC68692.1 LENGTH 40 SQ:AASEQ MGIDTAAIIRYLVTAHFSLAILVPDAAGILENVQIGRTAE GT:EXON 1|1-40:0| TM:NTM 1 TM:REGION 4->26| HM:PFM:NREP 1 HM:PFM:REP 1->23|PF09834|0.001|26.1|23/53|DUF2061| OP:NHOMO 4 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------211----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 38-40| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc //