[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68696.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  79/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.62.1
:478 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   306->436 1auqA PDBj 7e-07 13.0 %
:RPS:SCOP  306->436 1auqA  c.62.1.1 * 8e-07 13.0 %
:HMM:SCOP  311->480 1yvrA2 c.62.1.5 * 5.9e-10 20.8 %
:HMM:PFM   254->461 PF05762 * VWA_CoxE 1.3e-33 32.3 198/222  
:BLT:SWISS 191->441 YEHP_ECOLI 2e-38 33.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68696.1 GT:GENE BAC68696.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1251356..1252792) GB:FROM 1251356 GB:TO 1252792 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF05762: VWA domain containing CoxE-like protein GB:PROTEIN_ID BAC68696.1 LENGTH 478 SQ:AASEQ MTERTTEHTPEQNAEADSDENRRQVLYWRLLARLFDHEEQATLESASLAVVEDIGLPSGLLDPGTSVDSIVQRHPELASEFDGLMVPEPEPDDDGRDRAAEVRRAALVSKVLLNVFAAGSGTVTAGQLSRWQSDAGWLERALGCRPGELRGGRPGGGRAGRGAGPAGTGGRGATPDLGRLIPAIGPELGAIEADLVKRMHLREVLADPTLAAQLTPSMSLIEQLLRDKNNLSGVALANAKALIRRFVDEVAEVLRTQVAQATAGALDRSVPPKRTFRNLDLDRTIWKNLTNWSPEEERLYVDRLYYRHTARKTTPQRLIVVVDQSGSMVDSMVNCTILASIFAGLPKVDVHLIAYDTRAIDLTPWVSDPFEMLLRTNLGGGNDGPVAMAMARPKITEPRSTVMVWISDFYEFDRSQPLFEGIEAVHRSGVKFIPVGSVTSSGRQEVNPWFRERFKALGTPVVSGHIRKLVHELKTFLA GT:EXON 1|1-478:0| BL:SWS:NREP 1 BL:SWS:REP 191->441|YEHP_ECOLI|2e-38|33.5|248/378| SEG 87->94|pepepddd| SEG 143->175|gcrpgelrggrpgggragrgagpagtggrgatp| RP:PDB:NREP 1 RP:PDB:REP 306->436|1auqA|7e-07|13.0|131/208| HM:PFM:NREP 1 HM:PFM:REP 254->461|PF05762|1.3e-33|32.3|198/222|VWA_CoxE| RP:SCP:NREP 1 RP:SCP:REP 306->436|1auqA|8e-07|13.0|131/208|c.62.1.1| HM:SCP:REP 311->480|1yvrA2|5.9e-10|20.8|159/0|c.62.1.5|1/1|vWA-like| OP:NHOMO 91 OP:NHOMOORG 79 OP:PATTERN -------------------------------------------------------------------- ----2-------------------------------1211-1-11-------1-------12--2--2331-------------------1---------1----1----------------------------------1---1-1--1---------------------------------1-----------------------------------------------11----------------------------------------------------------------------------------------------1--------------------------------------------1--1------------1---------------------11-11-11-1-----1----------------------------------------------------------------------------------------------------1----------------11--1----------------------------------------------------1-------------------------------------------------------------------------------1111111111-1-1121111-111111111-------1-----------------1-211-------------------------------2---------------------------------------------------------------------------------------1----11------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 157 STR:RPRED 32.8 SQ:SECSTR #######################################################################################################################################################################################################################################################################################EccGGGTTccTTcccGGGcGGGccEEccccccccccEEEEEEEEccTTccHHHHHHHHHHTccccTTcEEEEEEEEcccEEEEEcTTcccHHHTccccccccccHHHHHHHHHHTTccccEEEEEEEEcccccGGGTTHHHHHHHHHHTTEEEEEEE########################################## DISOP:02AL 1-22, 90-98, 150-172, 263-274| PSIPRED ccccccccccccccccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHcHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHcccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcEEEccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccEEEEEEEccccHHHHHHHHHHHHHHHHHccccEEEEEEEEEEEEEccHHHccHHHHHHHccccccccHHHHHHHHHHHHcccccEEEEEEEcccccccHHHHHHHHHHHHHcccEEEEEccccccccccccHHHHHHHHHccccEEEccHHHHHHHHHHHHc //