[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68699.1
DDBJ      :             putative phosphotransferase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  64/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.144.1
:307 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   196->232 1j7lA PDBj 3e-05 45.9 %
:RPS:PDB   15->271 2ckpA PDBj 3e-08 11.4 %
:RPS:SCOP  66->266 1j7iA  d.144.1.6 * 2e-16 19.8 %
:HMM:SCOP  19->271 1nd4A_ d.144.1.6 * 4e-48 30.5 %
:RPS:PFM   186->232 PF01636 * APH 4e-05 51.1 %
:HMM:PFM   39->262 PF01636 * APH 1.2e-34 28.1 217/238  
:BLT:SWISS 5->55 PDXH_XANP2 9e-04 37.3 %
:BLT:SWISS 26->61 PDXH_BRUSU 5e-04 41.7 %
:BLT:SWISS 179->253 KKA8_ECOLX 1e-06 34.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68699.1 GT:GENE BAC68699.1 GT:PRODUCT putative phosphotransferase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1254946..1255869 GB:FROM 1254946 GB:TO 1255869 GB:DIRECTION + GB:PRODUCT putative phosphotransferase GB:NOTE PF01636: Phosphotransferase enzyme family GB:PROTEIN_ID BAC68699.1 LENGTH 307 SQ:AASEQ MPTTPPDGRSGIDAALVSRLIAAQFPQWSGLPVTPVDIDGWDNRTYRLGDDMTARLPTAAGYVPAVTKEHEWLPRLAPSLPVAIPPILAMGVPGEGYPFPWSVRGWLPGERADRGRIDDLSQFAVSVAEFVLALQRCDTTGGPLAGEHSWYRGASPAHYDDETRRCLAALEGRVDTDRAATVWGAALAAPWDGNPVWFHGDVGAGNLLVADGKLAAVIDFGTSGVGDPACDLVIAWGMFSGDSRDAFRRAVGQDEGTWARARGWALWKSLLTLAECIDTDPEQAAVNRRLIGHVLEDHRRFAQPSVA GT:EXON 1|1-307:0| BL:SWS:NREP 3 BL:SWS:REP 5->55|PDXH_XANP2|9e-04|37.3|51/100| BL:SWS:REP 26->61|PDXH_BRUSU|5e-04|41.7|36/208| BL:SWS:REP 179->253|KKA8_ECOLX|1e-06|34.7|75/271| BL:PDB:NREP 1 BL:PDB:REP 196->232|1j7lA|3e-05|45.9|37/263| RP:PDB:NREP 1 RP:PDB:REP 15->271|2ckpA|3e-08|11.4|237/316| RP:PFM:NREP 1 RP:PFM:REP 186->232|PF01636|4e-05|51.1|47/221|APH| HM:PFM:NREP 1 HM:PFM:REP 39->262|PF01636|1.2e-34|28.1|217/238|APH| RP:SCP:NREP 1 RP:SCP:REP 66->266|1j7iA|2e-16|19.8|192/260|d.144.1.6| HM:SCP:REP 19->271|1nd4A_|4e-48|30.5|246/255|d.144.1.6|1/1|Protein kinase-like (PK-like)| OP:NHOMO 75 OP:NHOMOORG 64 OP:PATTERN -------------------------------------------------------------------- ----2---------1--12-1---1-11111------1-1-1-222-1------1--3---1----1312---------------------------------------------------------------------1----1-------------------------------------------------111111---1-111-1-----111-------------11-------------------------------------------111--------------------------------------------------------------------------------------------------------------------------------------------1---112--1---11---1--------------------------------------1-1---11----1----1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 283 STR:RPRED 92.2 SQ:SECSTR ##############HHHHHHccTHHHHccGGGccccEEcccccEEEEEEccccEEEEEHHHHEccccHHHHHHHHHHHTTccccEEEEEEcTTT##EETTEEEEEccccccccGGGTTcHHHHHHHHHHHHHHHHHccccccccTTHHHHHHHHHHHHHccHHHHHHHHHTTcHHHHHHHHHH##HHHHTccccEEEEcccccGGGcccccccTTcEEEEHHHHHHHHHHTTHHHcEEcccccTTccEEcGGGcccHHHHHHHHHHHHHHHHHTTcccccHHHHHHHHHHHcHHHHHHHHH###### DISOP:02AL 1-5, 304-307| PSIPRED cccccccccccccHHHHHHHHHHHccccccccEEEEEcccccccEEEEcccEEEEcccccccHHHHHHHHHHHHHHHcccccccccEEEEcccccccccccEEEEEEccccccccccccHHHHHHHHHHHHHHHHccccccccccccHHHHccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccEEEEcccccccEEEEccEEEEEEEccccccccHHHHHHHHHHHccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccccc //