[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68700.1
DDBJ      :             putative secreted protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:151 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   53->91 PF03372 * Exo_endo_phos 0.00046 23.1 39/276  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68700.1 GT:GENE BAC68700.1 GT:PRODUCT putative secreted protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1256164..1256619 GB:FROM 1256164 GB:TO 1256619 GB:DIRECTION + GB:PRODUCT putative secreted protein GB:PROTEIN_ID BAC68700.1 LENGTH 151 SQ:AASEQ MRTHTVKTLVTLCAAVSLAAATGSSSAAPPTARAVKQQPERTVLVDCFWKPNVRPTDFILACGDGNSRLSSLKWSHWNLNSATAKGFNLVNDCKPYCAAGKFHSYAVVVRLDHPQPWKKRPQVQHYTQMSLVYTDNRPDGFERTVTYPLWN GT:EXON 1|1-151:0| TM:NTM 1 TM:REGION 2->23| SEG 8->35|tlvtlcaavslaaatgsssaapptarav| HM:PFM:NREP 1 HM:PFM:REP 53->91|PF03372|0.00046|23.1|39/276|Exo_endo_phos| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- --------------------------------------1--------1-------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 28-35| PSIPRED ccccHHHHHHHHHHHHHHHHccccccccccccccccccccccEEEEEEEcccccccEEEEEccccccEEEEEEEEEEcccccccccEEEEEccccccccccEEcEEEEEEEEcccccccccccEEEEEEEEEEcccccccccEEEEEcccc //