[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68701.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  11/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.1.16
:148 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  30->126 1ifrA  b.1.16.1 * 4e-12 17.5 %
:HMM:SCOP  40->137 1ufgA_ b.1.16.1 * 3.8e-12 21.4 %
:HMM:PFM   41->118 PF00932 * IF_tail 5.6e-07 24.4 78/118  
:BLT:SWISS 24->114 ACC4A_DANRE 1e-05 27.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68701.1 GT:GENE BAC68701.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1257106..1257552 GB:FROM 1257106 GB:TO 1257552 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68701.1 LENGTH 148 SQ:AASEQ MSVAALPASADQDRQPHRQRVEISNVHYDAPGRDDRSNRSLNQEWVDITNTGRHSVNLDDWTLSNRDGRTYTFHHLRLEGHSTVRVHTGNGRDTHRDVYQDRRHEVWNDRSDTATLRNDHGRVIDTASWGRGSHERRGGHEGHGHSRR GT:EXON 1|1-148:0| BL:SWS:NREP 1 BL:SWS:REP 24->114|ACC4A_DANRE|1e-05|27.5|91/539| SEG 130->147|grgsherrggheghghsr| HM:PFM:NREP 1 HM:PFM:REP 41->118|PF00932|5.6e-07|24.4|78/118|IF_tail| RP:SCP:NREP 1 RP:SCP:REP 30->126|1ifrA|4e-12|17.5|97/113|b.1.16.1| HM:SCP:REP 40->137|1ufgA_|3.8e-12|21.4|98/0|b.1.16.1|1/1|Lamin A/C globular tail domain| OP:NHOMO 21 OP:NHOMOORG 18 OP:PATTERN ------------------------11111-1-------------2-1-1---1------1-------- -----------------------------------------------1-------------------211------------------------------------------------------------------211-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 6-8, 135-148| PSIPRED cEEEEcccccccccccccccEEEEEEEEccccccccccccccccEEEEEEcccccEEEcccEEEEccccEEEccccEEccccEEEEEEcccccccccEEccccccEEEccccEEEEEcccccEEEEEEccccccHHcccccccccccc //