[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68703.1
DDBJ      :             putative cysteine transferase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  61/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.32.1
:142 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   20->134 1npbD PDBj 9e-09 38.1 %
:RPS:PDB   19->138 1ecsA PDBj 3e-11 15.4 %
:RPS:SCOP  11->139 1dhyA2  d.32.1.3 * 1e-12 15.6 %
:HMM:SCOP  17->139 1q0oA2 d.32.1.3 * 8.3e-17 29.8 %
:HMM:PFM   20->134 PF00903 * Glyoxalase 1.6e-10 29.4 109/128  
:BLT:SWISS 20->134 FOSA_SERMA 3e-08 38.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68703.1 GT:GENE BAC68703.1 GT:PRODUCT putative cysteine transferase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1258992..1259420) GB:FROM 1258992 GB:TO 1259420 GB:DIRECTION - GB:PRODUCT putative cysteine transferase GB:NOTE PF00903: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily GB:PROTEIN_ID BAC68703.1 LENGTH 142 SQ:AASEQ MSHEQQYQDESQLPATTAQLNHTAVYAGDRRLSAEFLAAILGLKVGAPFGPFLPVDLGNGVTLDYYEKTGEPIQSQHYAFLVPDAQFGGMIARLEAVGVTYYADPNHTEPGQINRLFGGRGAYFADPDGHNMEIMTRPYIRP GT:EXON 1|1-142:0| BL:SWS:NREP 1 BL:SWS:REP 20->134|FOSA_SERMA|3e-08|38.1|105/141| BL:PDB:NREP 1 BL:PDB:REP 20->134|1npbD|9e-09|38.1|105/137| RP:PDB:NREP 1 RP:PDB:REP 19->138|1ecsA|3e-11|15.4|117/120| HM:PFM:NREP 1 HM:PFM:REP 20->134|PF00903|1.6e-10|29.4|109/128|Glyoxalase| RP:SCP:NREP 1 RP:SCP:REP 11->139|1dhyA2|1e-12|15.6|122/146|d.32.1.3| HM:SCP:REP 17->139|1q0oA2|8.3e-17|29.8|114/0|d.32.1.3|1/1|Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase| OP:NHOMO 66 OP:NHOMOORG 61 OP:PATTERN -------------------------------------------------------------------- --------------111-------11-----111112111-2111--1----1----1-------11211-----------------------------------------------------------------------------11------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------1-------111111-----11--1111-11--111-----1------12---1-----------------1--------------------------------2--------------------------------------------------------------1-----------------------------------------------------------------------------------------------------1111--------------------------------------------------------------1----------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 142 STR:RPRED 100.0 SQ:SECSTR cccccccccccccccccccccccEEEEccHHHHHHHHHTTTTcEEEEEcccEEEEEETTEEEEEEEcTTccGGGccEEEEEEccccHHHHHHHHHHTTcccccccccEEEEEEEcTTccEEEEEEcTTccEEEEEEccTccT DISOP:02AL 1-17| PSIPRED ccHHHHHHcccccccccEEEEEEEEEEccHHHHHHHHHHHHccccccccccEEEEEEccccEEEEcccccccccccEEEEEEcHHHHHHHHHHHHHcccEEEcccccccccEEEccccccEEEEEcccccEEEEEEcccccc //