[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68705.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:144 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 18->95 HSLU_LISW6 7e-04 26.9 %
:BLT:SWISS 85->141 RS13_ALKOO 3e-05 42.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68705.1 GT:GENE BAC68705.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1261279..1261713) GB:FROM 1261279 GB:TO 1261713 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68705.1 LENGTH 144 SQ:AASEQ MNESELSPEGGRPVDLYLDLLRIRMAPADYELLLRMVEPALKAVEDQSAGPIELSLEGAEGSTVSQEIRDEASLVLAVAVTGRLDNQIVEIETEEVGPVRIVTDADTAVDPDRRREIADFIGERHRQDEELRGIAEVSGLPTDV GT:EXON 1|1-144:0| BL:SWS:NREP 2 BL:SWS:REP 18->95|HSLU_LISW6|7e-04|26.9|78/100| BL:SWS:REP 85->141|RS13_ALKOO|3e-05|42.9|56/123| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-10, 142-144| PSIPRED cccccccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHHHHEEEEEEEEcccccEEEEEEEcccccEEEEEcccccccHHHHHHHHHHHHHHHccHHHHHHHHHHccccccc //