[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68709.1
DDBJ      :             hypothetical protein
Swiss-Prot:CAAL2_STRAW  RecName: Full=Carboxylate-amine ligase SAV_999;         EC=6.3.-.-;

Homologs  Archaea  8/68 : Bacteria  219/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.128.1
:366 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   4->294 1tt4A PDBj 6e-28 30.7 %
:RPS:PDB   4->343 2d32B PDBj 3e-38 16.8 %
:RPS:SCOP  2->342 1r8gA  d.128.1.3 * 9e-41 25.5 %
:HMM:SCOP  3->364 1r8gA_ d.128.1.3 * 3.3e-92 38.5 %
:RPS:PFM   5->239 PF04107 * GCS2 4e-30 40.9 %
:HMM:PFM   5->288 PF04107 * GCS2 1.9e-60 33.1 281/290  
:BLT:SWISS 1->366 CAAL2_STRAW 0.0 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68709.1 GT:GENE BAC68709.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1265082..1266182) GB:FROM 1265082 GB:TO 1266182 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF04107: Glutamate-cysteine ligase family 2(GCS2) GB:PROTEIN_ID BAC68709.1 LENGTH 366 SQ:AASEQ MSLYTVGVEEEYLLLDPATRLPMPAAEQVRAAAGLEPIAGEDEIQPELSEAQVEVATPVCTSLDEIGGHLVRLRHVLGRAAESNGCRLAACGTPPIKEESPPPLTNNPRYRAMRAQAPQLVAEQLVCGTHVHVGVPDPEIGVAVLNRIRLWLPVLVAMSANSPFWAGHDTGFASWRTVIFGRWPVSGPPPHFADLADHEKRVQQLLTCGVIFDPGQLYWQARLSSRYPTVEVRCLDVQLRADDAVMFAGIVRALVATAINDAKAGVPVPSCPPELLQGANWHAARHGLSGSLIDYEGRRRSAGDVLSQLMDHIGPALDAADDSREVASLVHRLLREGTPADRQRRALLRGGLRAVTDLIITESAVT GT:EXON 1|1-366:0| SW:ID CAAL2_STRAW SW:DE RecName: Full=Carboxylate-amine ligase SAV_999; EC=6.3.-.-; SW:GN OrderedLocusNames=SAV_999; SW:KW ATP-binding; Complete proteome; Ligase; Nucleotide-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->366|CAAL2_STRAW|0.0|100.0|366/366| GO:SWS:NREP 3 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0016874|"GO:ligase activity"|Ligase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| SEG 344->354|rrallrgglra| BL:PDB:NREP 1 BL:PDB:REP 4->294|1tt4A|6e-28|30.7|270/354| RP:PDB:NREP 1 RP:PDB:REP 4->343|2d32B|3e-38|16.8|333/499| RP:PFM:NREP 1 RP:PFM:REP 5->239|PF04107|4e-30|40.9|232/285|GCS2| HM:PFM:NREP 1 HM:PFM:REP 5->288|PF04107|1.9e-60|33.1|281/290|GCS2| GO:PFM:NREP 2 GO:PFM GO:0004357|"GO:glutamate-cysteine ligase activity"|PF04107|IPR006336| GO:PFM GO:0006750|"GO:glutathione biosynthetic process"|PF04107|IPR006336| RP:SCP:NREP 1 RP:SCP:REP 2->342|1r8gA|9e-41|25.5|321/352|d.128.1.3| HM:SCP:REP 3->364|1r8gA_|3.3e-92|38.5|358/368|d.128.1.3|1/1|Glutamine synthetase/guanido kinase| OP:NHOMO 282 OP:NHOMOORG 228 OP:PATTERN ------------------------11111111------------------------------------ --1-311211111121211-12--2311111221222343-32222--1111332211--113-3-22111-----------3--1-------------1-----1-1-1--------------------------11111---1---------------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-----------111--------------------22222122----------------11---111------1---------------1-----------------------------------111111111111111111121111111111111--11111111111-1111-----11---------1-111----------------------------1------------------------------------------------------------------------21---1-1111111111-1121111111111111111111-----1111111111111111-1111111-----------------------2212--------------------------------111111--1111------------------------------------------------------------------------------------------------------ --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 340 STR:RPRED 92.9 SQ:SECSTR ###cEEEEEEEEEEEcTTcccccccccGGGccTTTccGcccccEEEcccTTEEEEEccccccHHHHHHHHHHHHHHHHTccTTcEEccccccccccTTcccccccHHHHHHHHHHHHHHccGGGGccEEEEEEEccHHHHHHHHHHHHHHHTTHHHHHHccccEEcGGGccccccccGGGcTTcccccGGGccccccHHHHHHHHccccccccGGGccccEEEEHcccEEEEEEEEccTTcTTcccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHTTcTTcEEccTTTccccEEHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHGGGcHHHHH####################### PSIPRED cccccccHHHHHHHHccccccccccHHHHHHHcccccccccccEEEcccccEEEEEccccccHHHHHHHHHHHHHHHHHHHHHcccEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHcccccEEEccHHHHHHHHHHHHccccccccccEEEccccccccccEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHccccEEEEcccccEEEHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHHccc //