[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68712.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  18/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.129.3
:158 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   3->141 2b79A PDBj 3e-10 9.0 %
:RPS:SCOP  3->150 2rerA1  d.129.3.6 * 4e-12 11.5 %
:HMM:SCOP  1->143 1z94A1 d.129.3.5 * 1.1e-15 19.9 %
:HMM:PFM   4->140 PF10604 * Polyketide_cyc2 1.6e-10 22.1 131/139  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68712.1 GT:GENE BAC68712.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1269949..1270425) GB:FROM 1269949 GB:TO 1270425 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF03364: Streptomyces cyclase/dehydrase GB:PROTEIN_ID BAC68712.1 LENGTH 158 SQ:AASEQ MAVRHRVIKRSPRDVWAVLADGTRYGDWVVGTSASYPVRGEWPQVHSAICYEVRIGFLTLTNETVVRACVDGRELELEAQAGPLGSARIAIEVRPWGEHSLVIIDEHPLKGVGGTLHNVGVEALIQLRHRSMLGRLAEVCEKEHQGTEQARGASPLRS GT:EXON 1|1-158:0| RP:PDB:NREP 1 RP:PDB:REP 3->141|2b79A|3e-10|9.0|133/142| HM:PFM:NREP 1 HM:PFM:REP 4->140|PF10604|1.6e-10|22.1|131/139|Polyketide_cyc2| RP:SCP:NREP 1 RP:SCP:REP 3->150|2rerA1|4e-12|11.5|148/155|d.129.3.6| HM:SCP:REP 1->143|1z94A1|1.1e-15|19.9|136/0|d.129.3.5|1/1|Bet v1-like| OP:NHOMO 19 OP:NHOMOORG 18 OP:PATTERN -------------------------------------------------------------------- ---------------11----1---1------11111------------11-111-------1-1--12------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 143 STR:RPRED 90.5 SQ:SECSTR ##EEEEEEcccHHHHHHHHHcGGGGGGTcTTEEEEEEcccccTTcEEEEEEEEEETTccccEEEEEccccTTTEEEEEEEcETTEEEEEEEEEEEcTTccEEEEEEEEEccccccTTHHHHHHHHHTTHHHHHHHHHHHHTcccc############# DISOP:02AL 1-3, 145-158| PSIPRED cccccHHHHccHHHHHHHHHccEEEEEEEEEccEEEEccccccccccEEEEEEEEEEEEEcccEEEEEcccccEEEEEEEcccccEEEEEEEEEEcccEEEEEEEEEccccccEEcccHHHHHHEEcccHHHHHHHHHHHHHHHHHHHHHcccccccc //