[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68714.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.13.2
:116 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  2->88 1th8B  c.13.2.1 * 2e-04 19.5 %
:HMM:PFM   68->106 PF01207 * Dus 4.8e-05 15.4 39/310  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68714.1 GT:GENE BAC68714.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1271761..1272111 GB:FROM 1271761 GB:TO 1272111 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68714.1 LENGTH 116 SQ:AASEQ MLSHSIEHGVLVITLHTDPGIGRRAALSHEITDLVHAYSPLPVVIVLDMPEVGSATVSAILRAQRMCHHLGVLMSVSTHSAATRRILEANCDTGGTRLVVHARTDVAIAAAFTAAA GT:EXON 1|1-116:0| SEG 107->115|aiaaaftaa| HM:PFM:NREP 1 HM:PFM:REP 68->106|PF01207|4.8e-05|15.4|39/310|Dus| RP:SCP:NREP 1 RP:SCP:REP 2->88|1th8B|2e-04|19.5|87/115|c.13.2.1| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED cccccccccEEEEEEEccccccccHHHHHHHHHHHHccccccEEEEEEcccccHHHHHHHHHHHHHHHHHEEEEEEEcccHHHHHHHHccccccccEEEEEEEccEEEHHHEEccc //