[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68715.1
DDBJ      :             putative oxidoreductase
Swiss-Prot:             

Homologs  Archaea  53/68 : Bacteria  312/915 : Eukaryota  8/199 : Viruses  0/175   --->[See Alignment]
d.37.1
:139 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->120 1xkfB PDBj 5e-15 33.9 %
:RPS:PDB   5->119 3ddjA PDBj 2e-14 15.7 %
:RPS:SCOP  5->122 2yziA1  d.37.1.1 * 4e-19 27.4 %
:HMM:SCOP  1->55 2o16A2 d.37.1.1 * 6.9e-13 47.3 %
:HMM:SCOP  60->137 2nycA1 d.37.1.1 * 9.7e-10 34.6 %
:HMM:PFM   5->55 PF00571 * CBS 9.9e-18 35.3 51/57  
:HMM:PFM   73->122 PF00571 * CBS 1.6e-13 40.0 50/57  
:BLT:SWISS 5->130 YHCV_BACSU 8e-21 39.5 %
:REPEAT 2|3->66|68->131

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68715.1 GT:GENE BAC68715.1 GT:PRODUCT putative oxidoreductase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1272152..1272571) GB:FROM 1272152 GB:TO 1272571 GB:DIRECTION - GB:PRODUCT putative oxidoreductase GB:NOTE PF00571: CBS domain GB:PROTEIN_ID BAC68715.1 LENGTH 139 SQ:AASEQ MAQLVREIMTSDITMVEPQTSVVEVARLMREQDIGAVVVAENGRLRGLVTDRDLVVRALADGGSVDDRTVYSACSAELVSVAPDDDVDRAVYLMGARAVRRMLVVEDGRLVGIVSLGDVAVARHADSALGDISAADPNH GT:EXON 1|1-139:0| BL:SWS:NREP 1 BL:SWS:REP 5->130|YHCV_BACSU|8e-21|39.5|124/140| NREPEAT 1 REPEAT 2|3->66|68->131| BL:PDB:NREP 1 BL:PDB:REP 6->120|1xkfB|5e-15|33.9|115/123| RP:PDB:NREP 1 RP:PDB:REP 5->119|3ddjA|2e-14|15.7|115/270| HM:PFM:NREP 2 HM:PFM:REP 5->55|PF00571|9.9e-18|35.3|51/57|CBS| HM:PFM:REP 73->122|PF00571|1.6e-13|40.0|50/57|CBS| RP:SCP:NREP 1 RP:SCP:REP 5->122|2yziA1|4e-19|27.4|117/132|d.37.1.1| HM:SCP:REP 1->55|2o16A2|6.9e-13|47.3|55/0|d.37.1.1|1/2|CBS-domain| HM:SCP:REP 60->137|2nycA1|9.7e-10|34.6|78/0|d.37.1.1|2/2|CBS-domain| OP:NHOMO 636 OP:NHOMOORG 373 OP:PATTERN 32-4-263555555561-2-33511--1-1-12-2121-1--111132111114222-2312112--4 -11-21-------1-1111-11---111111-3---21112113-1------11------331-12231-1-----------2--1-1-------------1---1-111---------------1----------333------31-1----------------------------------11-3311-122111111111111111-13312111122----------11----------------------------------------------111------------------------------------------11111111111-1-1-111----11--1--2111211-3112----------1112-----1122321-12111----------1-11111-113-1-3--1223111221--1121-1222111--------1----221------------------------------2-1--111114554542222266353333134642511--1-131222243341-32211111--------233311------112-111----2----1123132-----------------------1---------1-----2-----------1---1111---13-2---------------------------------------------------------------------------------------------111111211--1-1---------------1111111-----3233111121111----------------------------22-1111-----------111111-------------------------------------1---11111-1- ----11-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1113--1--1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 127 STR:RPRED 91.4 SQ:SECSTR cccccHHHHccccccEETTccHHHHHHHHHHTccEEEEEcTTccEEEEEEHHHHHHHHHHHHHHTcTHHcHHHHccccccccTTccHHHHHHHHHHTccEEEEEcTTccEEEEEEHHHHcEEEEHHH############ DISOP:02AL 128-139| PSIPRED ccccHHHHcccccEEEcccccHHHHHHHHHHccccEEEEEcccEEEEEEEHHHHHHHHHHcccccccccHHHHcccccEEEcccccHHHHHHHHHHccccEEEEEEccEEEEEEEHHHHHHHHHHHHHHHHHccccccc //