[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68716.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:93 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   34->85 PF04226 * Transgly_assoc 1.3e-11 33.3 48/48  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68716.1 GT:GENE BAC68716.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1272888..1273169) GB:FROM 1272888 GB:TO 1273169 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF04226: Transglycosylase associated protein GB:PROTEIN_ID BAC68716.1 LENGTH 93 SQ:AASEQ MVGILAWILIGLLAGAIAKLLLPGKDPGGIIVTMLIGIAGGLLGGWLGKVIFKVDSIDGFFDLSTWIAAIVGSLILLLLYRAVTGNRRSHRHA GT:EXON 1|1-93:0| TM:NTM 3 TM:REGION 2->24| TM:REGION 31->53| TM:REGION 63->85| SEG 3->24|gilawiligllagaiaklllpg| SEG 35->48|ligiaggllggwlg| HM:PFM:NREP 1 HM:PFM:REP 34->85|PF04226|1.3e-11|33.3|48/48|Transgly_assoc| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 85-93| PSIPRED cHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccc //