[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68717.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:175 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68717.1 GT:GENE BAC68717.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1273736..1274263 GB:FROM 1273736 GB:TO 1274263 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68717.1 LENGTH 175 SQ:AASEQ MRSTQMRRLGLAAVFALVLALFGLAPSASAADPGPADLTFATDSATTQPGGTVKLSMTITNNKTYDIWFIYQTIEPTWLTTQRPDLKYSFTGCSLATAAGSTPCSGTGPANLGTNYGATIPPGQSRTVTLTLQVAADSGCNGNIGFYSYYYAEFSDSTNTSGGPAYTPETRVLCS GT:EXON 1|1-175:0| TM:NTM 1 TM:REGION 9->31| SEG 9->38|lglaavfalvlalfglapsasaadpgpadl| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8| PSIPRED ccccHHHHHHHHHHHHHHHHHHccccccccccccccEEEEEccccccccccEEEEEEEEEcccEEEEEEEEEEcccEEEEccccccEEEEcccEEEEccccccccccccccccccccccccccccEEEEEEEEEEEcccccccccEEEEEEEEEccccccccccccccccEEEEc //