[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68722.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  38/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.2.1
:72 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   24->58 2cnbC PDBj 1e-07 25.7 %
:RPS:PDB   37->68 3dxfB PDBj 6e-04 18.8 %
:RPS:SCOP  24->72 1rkxA  c.2.1.2 * 1e-08 25.5 %
:HMM:SCOP  22->57 1eq2A_ c.2.1.2 * 1.3e-05 47.2 %
:HMM:PFM   16->64 PF11468 * PTase_Orf2 0.00043 22.4 49/294  
:BLT:SWISS 25->56 RFBB_XANCP 4e-05 46.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68722.1 GT:GENE BAC68722.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1280798..1281016 GB:FROM 1280798 GB:TO 1281016 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68722.1 LENGTH 72 SQ:AASEQ MNGRLPRRGAEDAQRIRPANSEVMRLVADASRLNAATGWSPAHDLEQGLAHTVEFFRDPANLARYKTGIYNI GT:EXON 1|1-72:0| BL:SWS:NREP 1 BL:SWS:REP 25->56|RFBB_XANCP|4e-05|46.9|32/351| RP:PDB:NREP 2 RP:PDB:REP 24->58|2cnbC|1e-07|25.7|35/366| RP:PDB:REP 37->68|3dxfB|6e-04|18.8|32/282| HM:PFM:NREP 1 HM:PFM:REP 16->64|PF11468|0.00043|22.4|49/294|PTase_Orf2| RP:SCP:NREP 1 RP:SCP:REP 24->72|1rkxA|1e-08|25.5|47/349|c.2.1.2| HM:SCP:REP 22->57|1eq2A_|1.3e-05|47.2|36/307|c.2.1.2|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 39 OP:NHOMOORG 38 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------2-----------------1-----------------------------------------------1-----------------------1--------------------1--1---1---------------------------------1---------------------------------------------------------------------------------------------------------------1-1-1-1--111-----1----------------1---------------------1---------------------------1-----------1---1------------------------------1---------------------------------------------------------------------------------------------1--------------1-----1--1-----1-----1--------1------11--11-----------------------------11------------------------------------------------------------------------------------------------------------------------------1-------------------------------1-----------------------1--------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 67 STR:RPRED 93.1 SQ:SECSTR #####TTcEEEEHHHTTcccccccEEccccHHHHHHHccccccccHHHHHHHHHHHHHHHcTTccccTTccc DISOP:02AL 1-2| PSIPRED ccccccccccccHHHcccccccHHHHHHcHHHHHHHHcccccccHHHHHHHHHHHHHcHHHHHHHccccccc //