[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68725.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  13/915 : Eukaryota  12/199 : Viruses  0/175   --->[See Alignment]
:220 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   3->179 PF12138 * Spherulin4 2e-14 34.7 %
:HMM:PFM   2->180 PF12138 * Spherulin4 5e-45 31.8 179/251  
:BLT:SWISS 1->146 SR4_PHYPO 6e-13 30.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68725.1 GT:GENE BAC68725.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1282693..1283355 GB:FROM 1282693 GB:TO 1283355 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68725.1 LENGTH 220 SQ:AASEQ MSLLIPLYVHPAEDPGAWHRLITAADRTYAVVLNPANGPGTSPDPAFAAAAGALRAAGARLLGYVDTNYGARTAAEVADDVVRHREWYAADGCFLDRVTSAPAELPLCKRLVQTVRRLGASPVVLNPGVHPAPGYARLADLVVTFEGHWSTYVSAFSRPAWTLRHPPERFCHLVYGVPEALVPLAVRTARERGAAVCGPVTGEIPNPWTRLTPALGETEQ GT:EXON 1|1-220:0| BL:SWS:NREP 1 BL:SWS:REP 1->146|SR4_PHYPO|6e-13|30.8|143/100| SEG 48->63|aaaagalraagarllg| RP:PFM:NREP 1 RP:PFM:REP 3->179|PF12138|2e-14|34.7|176/244|Spherulin4| HM:PFM:NREP 1 HM:PFM:REP 2->180|PF12138|5e-45|31.8|179/251|Spherulin4| OP:NHOMO 34 OP:NHOMOORG 26 OP:PATTERN --------------------------------------------------------------1----- -------------------------------------------------------------------311------------1----1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------1------1----------------111---1-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------1221211--------------------12----1------------------------------------------------------------------------------------------------------------------------------------2-----2------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 216-220| PSIPRED ccEEEEEEEcccccHHHHHHHcccccccEEEEEEccccccccccHHHHHHHHHHHHcccEEEEEEEccHHcccHHHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHHHHHccccEEEEcccccccHHHHccccEEEEEccccccHHcccccccccccccHHHHHHHHccccHHHHHHHHHHHHHHccEEEEEEcccccccHHHcccccccccc //