[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68727.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:120 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   15->110 PF04120 * Iron_permease 1e-07 31.2 %
:HMM:PFM   15->98 PF04120 * Iron_permease 3.1e-16 31.0 84/133  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68727.1 GT:GENE BAC68727.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1284066..1284428 GB:FROM 1284066 GB:TO 1284428 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE PF07300: Protein of unknown function (DUF1452) GB:PROTEIN_ID BAC68727.1 LENGTH 120 SQ:AASEQ MPHPAERSRHGRGWFEKLAEAASNLTSSPVFYCFCLLLVFAFIVAHAVGLELTWQLLIGDIMTAVNLLLLALLKNSERRAEHAIQHKLDSIAAALLEQREGHSRQAHEELRKAIGIEDEF GT:EXON 1|1-120:0| TM:NTM 2 TM:REGION 27->49| TM:REGION 54->76| SEG 67->73|llllall| RP:PFM:NREP 1 RP:PFM:REP 15->110|PF04120|1e-07|31.2|96/122|Iron_permease| HM:PFM:NREP 1 HM:PFM:REP 15->98|PF04120|3.1e-16|31.0|84/133|Iron_permease| GO:PFM:NREP 1 GO:PFM GO:0055085|"GO:transmembrane transport"|PF04120|IPR007251| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-9| PSIPRED ccccccccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccccc //