[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68728.1
DDBJ      :             putative integral membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  23/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:182 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   4->62 PF10156 * Med17 0.00048 18.6 59/467  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68728.1 GT:GENE BAC68728.1 GT:PRODUCT putative integral membrane protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1284484..1285032) GB:FROM 1284484 GB:TO 1285032 GB:DIRECTION - GB:PRODUCT putative integral membrane protein GB:NOTE PF06532: Protein of unknown function (DUF1109) GB:PROTEIN_ID BAC68728.1 LENGTH 182 SQ:AASEQ MSLIERRQRSSDEARTSQEGRASDSGTRADEGESEQERVNRRWQEILQETRVAQTGVQILFGFLLSVAFTPLFRELGTFDRGVYVAAVLLGAAATGALIAPVSIHRFLSGQRMKDELVAAAGRLMMGGIVLLALTIGCTVLLILHAVLPSSLAEILAGAVMLWFAFCWYLLPWILRSRADKG GT:EXON 1|1-182:0| TM:NTM 4 TM:REGION 53->75| TM:REGION 83->105| TM:REGION 121->143| TM:REGION 155->176| SEG 82->100|gvyvaavllgaaatgalia| HM:PFM:NREP 1 HM:PFM:REP 4->62|PF10156|0.00048|18.6|59/467|Med17| OP:NHOMO 28 OP:NHOMOORG 23 OP:PATTERN -------------------------------------------------------------------- ----1----------11---------------11112122-2111-------111-------1--1-121----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-37, 179-182| PSIPRED cccHHcccccccHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //