[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68738.1
DDBJ      :             putative multiple sugar ABC transporter solute-binding protein
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  160/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:445 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   65->444 2z8dA PDBj 1e-36 31.1 %
:RPS:PDB   49->398 3d4gE PDBj 2e-31 19.6 %
:RPS:SCOP  48->432 1eljA  c.94.1.1 * 6e-26 15.4 %
:HMM:SCOP  24->438 1eljA_ c.94.1.1 * 9.5e-75 28.5 %
:RPS:PFM   71->339 PF01547 * SBP_bac_1 2e-11 35.0 %
:HMM:PFM   62->340 PF01547 * SBP_bac_1 4.1e-37 25.4 268/314  
:BLT:SWISS 48->430 ARAN_BACSU 6e-28 31.6 %
:PROS 156->173|PS01037|SBP_BACTERIAL_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68738.1 GT:GENE BAC68738.1 GT:PRODUCT putative multiple sugar ABC transporter solute-binding protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1298401..1299738) GB:FROM 1298401 GB:TO 1299738 GB:DIRECTION - GB:PRODUCT putative multiple sugar ABC transporter solute-binding protein GB:NOTE malE, PF00497: Bacterial extracellular solute-binding proteins, family 3 GB:PROTEIN_ID BAC68738.1 LENGTH 445 SQ:AASEQ MRRTTRRLMRGLAVLSVLALGATACGGSDDDSADQKPVSAGDIQAALKKGGTVTVWAWEPTLKTVAADFEKKYPKVKINLVGERSGDKHYTALSNAISAEKGVPDIAQVEYFALGQYALTKGLTDLTPFGADKLKAKYTPGPWNAVSEGDKVYGLPMDSGPMALFYNKKVFDKYKVAVPTTWDEYVEAARKLHKADPKVYIAADAGDAGLTTSMLWQAGSRPYQVDGTKVKIDFADAGAKKYTDTWQKLIDEKLVAPIYGWTDDWYKGLGDGTIATLPSGAWMPANFVTGVPKASGDWRAAPLPAWTKGDKASAENGGSSLTVPELAKNKELAYAFVEYANAGDGVQTRIKQGAFPATTAELQSTEFQNTKFDYFGGQEANKIFADSAANVADDWSYLPFQQYANSIFNDTVGKAYISKTKLADALKSWQDASVKYGKEQGFTVE GT:EXON 1|1-445:0| BL:SWS:NREP 1 BL:SWS:REP 48->430|ARAN_BACSU|6e-28|31.6|364/433| PROS 156->173|PS01037|SBP_BACTERIAL_1|PDOC00796| SEG 1->24|mrrttrrlmrglavlsvlalgata| BL:PDB:NREP 1 BL:PDB:REP 65->444|2z8dA|1e-36|31.1|370/401| RP:PDB:NREP 1 RP:PDB:REP 49->398|3d4gE|2e-31|19.6|332/472| RP:PFM:NREP 1 RP:PFM:REP 71->339|PF01547|2e-11|35.0|246/282|SBP_bac_1| HM:PFM:NREP 1 HM:PFM:REP 62->340|PF01547|4.1e-37|25.4|268/314|SBP_bac_1| GO:PFM:NREP 2 GO:PFM GO:0005215|"GO:transporter activity"|PF01547|IPR006059| GO:PFM GO:0006810|"GO:transport"|PF01547|IPR006059| RP:SCP:NREP 1 RP:SCP:REP 48->432|1eljA|6e-26|15.4|363/380|c.94.1.1| HM:SCP:REP 24->438|1eljA_|9.5e-75|28.5|368/380|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 375 OP:NHOMOORG 165 OP:PATTERN ----------------1----------1--1-------------------------1----------- ---1C--------------------1-------111----1--2664-4762533--1--31-35129B812111755----------------------------------------------------------11121---2-1------------------------------------22-1133-221---------------5311-1-----311--3232223F--------------------22--22--131----22----------1-----1---11-111---1--------------11---111-21--5222223211-2-11-1113------1--------2---32121-1---------------------------1---11112----------2--133146454335----------------------------------------------------------------------------------------------------------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------1-11-------------------1------------------------------------1-1---------------------------------------------------------------2-111------1---1111----------------------------------------------23311-5-1---- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 408 STR:RPRED 91.7 SQ:SECSTR ####################################cEEEEccTTccccTTEEEEEccHHHHHHHHHHHHHHHHccEEEEEccTTHHHHHHHHHHHHHHTTccccEEEEEGGGHHHHHHTTccccccccHHHHHTHHccHHHHHHTEETTEEccEEEEEEccEEEEETTTccccTcccccccTTHHHHHHHHHHTTTcEEEccccccHHHHHHHHHHTTcEEETTEEEEEEEEcccHHHHHHHHHHHHHHHTTcccTTccHHHHHHHHHHTTcEEEEEEcGGGHHHHHHHHHHHTccEEEEccccccTTcccccEEEEEEEEEcTTcccHHHHHHHHHHTTccHHHHHHHHccccEEccHHHHHHHTTcHHHHHHHHHHHHcEEccccTTHHHHHHHHTHHHHHHHHHHHHHHHHHTTcccHHHHHHHHHccHHHHcccccccc# DISOP:02AL 1-4, 27-39, 443-445| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccEEEEEEccHHHHHHHHHHHHHcccEEEEEEEccccHHHHHHHHHHHHccccccEEEEEccHHHHHHHHccccccccHHHccHHHHHHHHHHHHHcccccEEEEEEEEcccEEEEEcHHHHHHccccccccHHHHHHHHHHHHHccccEEEEccccHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccHHHHHHHHcccEEEEEccccHHHHHHHHHccccccEEEEEccccccccccEEEEccEEEEEEcccccHHHHHHHHHHHccHHHHHHHHHcccccccHHHHccHHHHccccccccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccccc //