[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68739.1
DDBJ      :             putative multiple sugar ABC transporter permease protein
Swiss-Prot:             

Homologs  Archaea  28/68 : Bacteria  544/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:318 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   199->317 2r6gG PDBj 4e-11 31.6 %
:RPS:PDB   201->239 3dhwA PDBj 1e-09 38.5 %
:RPS:SCOP  78->317 2r6gG1  f.58.1.1 * 1e-15 21.7 %
:RPS:PFM   170->306 PF00528 * BPD_transp_1 3e-07 37.3 %
:HMM:PFM   127->305 PF00528 * BPD_transp_1 6.9e-16 24.4 168/185  
:BLT:SWISS 161->317 LPLC_BACSU 1e-23 35.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68739.1 GT:GENE BAC68739.1 GT:PRODUCT putative multiple sugar ABC transporter permease protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1299830..1300786) GB:FROM 1299830 GB:TO 1300786 GB:DIRECTION - GB:PRODUCT putative multiple sugar ABC transporter permease protein GB:NOTE malF, PF00528: Binding-protein-dependent transport system inner membrane component GB:PROTEIN_ID BAC68739.1 LENGTH 318 SQ:AASEQ MSSTSSPVTTDSQPASVPATGPTKGAPRLRTPRKHVPGRPKRSVPLTLLTGLVLLYTLVPLAWLVISATKTQEGLADSSGLWFAHDFALWDNISQTFTYDDGIFVRWLLNTLLYVVLGAGGATLLAILGGYALAKFTFPGKRAVFAVVIGAVAVPGTALAVPTFLMFSKMGLTDTPWAVIIPSLVSPFGLYLMWVFATEAIPVELLEAARIDGAGEVRTFFQVALPLLAPGIVTVLLFTTVATWNNYFLPLIMLKDPDWYPLTLGLSAWNAQAETIGGDVIFNLVITGSLLTIVPLIIAFLLLQKYWQSGLAAGSVKE GT:EXON 1|1-318:0| BL:SWS:NREP 1 BL:SWS:REP 161->317|LPLC_BACSU|1e-23|35.9|156/295| TM:NTM 6 TM:REGION 46->68| TM:REGION 107->129| TM:REGION 146->168| TM:REGION 182->204| TM:REGION 220->242| TM:REGION 279->301| SEG 46->65|ltlltglvllytlvplawlv| SEG 111->134|tllyvvlgaggatllailggyala| SEG 143->158|avfavvigavavpgta| BL:PDB:NREP 1 BL:PDB:REP 199->317|2r6gG|4e-11|31.6|114/284| RP:PDB:NREP 1 RP:PDB:REP 201->239|3dhwA|1e-09|38.5|39/203| RP:PFM:NREP 1 RP:PFM:REP 170->306|PF00528|3e-07|37.3|126/195|BPD_transp_1| HM:PFM:NREP 1 HM:PFM:REP 127->305|PF00528|6.9e-16|24.4|168/185|BPD_transp_1| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00528|IPR000515| GO:PFM GO:0006810|"GO:transport"|PF00528|IPR000515| GO:PFM GO:0016020|"GO:membrane"|PF00528|IPR000515| RP:SCP:NREP 1 RP:SCP:REP 78->317|2r6gG1|1e-15|21.7|235/284|f.58.1.1| OP:NHOMO 2857 OP:NHOMOORG 576 OP:PATTERN 11--2--11222122-51212---5--31-3-----------------------1231--1222---- ---1l213334-1123344-413347444443144414575326L*Y2DIG4QJN11B--967BG4COWI68555GDA1---3-----------------------------------------------------8AA67---6511-311-11111112212221333--1-----1----CD144DF-853222222331132223SH884822353928356676669*111111111111111-1---5311111-11133--11---1-42552325344422666777766664333344443333255---5553G4-291111121413C2--1445a-26232D--231--1F--1676I2-1-------111112-C981--324424466466666A---6--3--7J--STTIVTNigYPO22---6E57657B74--------1111---1---------------------------------2-133325665554233333674443334451112--1114-122224569-------3--------------1------1--11111---------221214----------1-------------------13-----1-2----------------------1---------2577-412222222222-222222232222122222255566--123222222222121224-112221--477777777777---------11111-45A--------------1------------11111222211113333-------------1111112-43311111111111111--------------------6--1-1----11111111--11----5KFB89Q8B9-1- -------------1------------------------------------------------------------------------------------------------------------------------------------------------2--------------------------1--------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 116 STR:RPRED 36.5 SQ:SECSTR ####################################################################################################################################################################################################ccTTccTTTTTHHHHHTccTHHHHHHTTHHHHHHHHHHHHHHHEEEEccHHHHHHHHTccccccccccccEEEcccccccHHH#####HHHHHHHTHHHHHHHHHHHTTTccccccTTTcc# DISOP:02AL 1-5, 8-44, 317-318| PSIPRED cccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHccccccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc //