[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68747.1
DDBJ      :             putative neutral zinc metalloprotease
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  180/915 : Eukaryota  14/199 : Viruses  0/175   --->[See Alignment]
b.1.6b.18.1d.92.1
:791 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   278->587 1keiA PDBj 7e-42 40.1 %
:RPS:PDB   263->582 1bqbA PDBj 4e-26 33.5 %
:RPS:SCOP  263->587 1bqbA  d.92.1.2 * 1e-71 35.9 %
:RPS:SCOP  687->790 1ot5A1  b.18.1.20 * 6e-24 23.1 %
:HMM:SCOP  255->588 8tlnE_ d.92.1.2 * 1.5e-76 44.2 %
:HMM:SCOP  593->679 1u2cA1 b.1.6.2 * 9e-11 36.0 %
:HMM:SCOP  666->791 1ot5A1 b.18.1.20 * 6.8e-22 32.2 %
:RPS:PFM   127->165 PF07504 * FTP 7e-09 61.5 %
:RPS:PFM   263->411 PF01447 * Peptidase_M4 2e-19 45.1 %
:RPS:PFM   413->587 PF02868 * Peptidase_M4_C 2e-20 46.5 %
:RPS:PFM   714->789 PF01483 * P_proprotein 4e-08 43.4 %
:HMM:PFM   413->587 PF02868 * Peptidase_M4_C 2.6e-54 50.9 159/163  
:HMM:PFM   262->410 PF01447 * Peptidase_M4 1.1e-29 41.5 142/151  
:HMM:PFM   713->790 PF01483 * P_proprotein 8.9e-22 42.3 78/87  
:HMM:PFM   125->167 PF07504 * FTP 1.1e-17 53.5 43/51  
:BLT:SWISS 213->670 LIE2_STREX 2e-60 37.2 %
:BLT:SWISS 681->790 LIE1_STREX 2e-35 61.8 %
:PROS 399->408|PS00142|ZINC_PROTEASE
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68747.1 GT:GENE BAC68747.1 GT:PRODUCT putative neutral zinc metalloprotease GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1309966..1312341) GB:FROM 1309966 GB:TO 1312341 GB:DIRECTION - GB:PRODUCT putative neutral zinc metalloprotease GB:NOTE PF02868: Thermolysin metallopeptidase, alpha-helical domain GB:PROTEIN_ID BAC68747.1 LENGTH 791 SQ:AASEQ MRRLPAQRDSRPPAPRRAALSAPFTGRPSQKEKPLSRPPRSSHRRRYTAALALTTAGTLFAAGFQTGVASAAPRDPGHAKIAATPRAGAAPAKLSPAKHAALLKSATAAVGDTAKSLGLGAKEKLIVKDVAKDADGTTHTRYERTYAGLPVLGGDLVVHLRNGGRTTVSEATKATVRVPAVTAKVSSATAAGKAVAAAKKADAKHPKIDGAPRLVVWAAGAKPVLAWESVVEGVQHDGTPSELHVITDATSGKAVFDFEDVRTGTGTGQFSGTVPLGSTLSGSTYELVDADRAGHRTYDLNQGTSGTGTLFTDDNDVWGDGTQSNRQTAGVDVAFGAAATWDYYKDVFGRNGIRNDGVAAYSRAHYGNAYVNAFWSDTCFCMTYGDGASNTHPLTALDVAAHEMSHGVTSATANLTYSGESGGLNEATSDIFAAAVEFHADLPADVPDYLVGEKIDIRGNGTPLRYMDKPSKDGSSRDSWDSSLGSIDVHYSSGPANHFFYLLSEGSGAKTVNGVSYDSPTSDGKAVTGIGIENAQRIWYRALTTYMTSTTNYAGARVATLQAAADLFGAYSDTYLAVAAAWAGINVGDRIALGVNIAPIADQTSGVGQEVSLQTDAYTTNSGAGLTYAATGLPDGLTLSDTGLISGVPTTAGTSEVTLTVTDSTGTAASVSFSWRVAHIYANGTRVDIPDAGAAVESPIVITGQTGNASATTQVYVKIVHTYRGDLTVDLVGPDGTVYSLLNHSGGSADNVDQTFTVDASAQPVDGTWKLRVRDTASIDVGYLQQWQLTP GT:EXON 1|1-791:0| BL:SWS:NREP 2 BL:SWS:REP 213->670|LIE2_STREX|2e-60|37.2|436/1090| BL:SWS:REP 681->790|LIE1_STREX|2e-35|61.8|110/438| PROS 399->408|PS00142|ZINC_PROTEASE|PDOC00129| SEG 5->23|paqrdsrppaprraalsap| SEG 34->46|plsrpprsshrrr| SEG 48->67|taalalttagtlfaagfqtg| SEG 79->93|akiaatpragaapak| SEG 180->204|avtakvssataagkavaaakkadak| SEG 471->486|skdgssrdswdsslgs| BL:PDB:NREP 1 BL:PDB:REP 278->587|1keiA|7e-42|40.1|287/316| RP:PDB:NREP 1 RP:PDB:REP 263->582|1bqbA|4e-26|33.5|284/301| RP:PFM:NREP 4 RP:PFM:REP 127->165|PF07504|7e-09|61.5|39/50|FTP| RP:PFM:REP 263->411|PF01447|2e-19|45.1|144/149|Peptidase_M4| RP:PFM:REP 413->587|PF02868|2e-20|46.5|157/161|Peptidase_M4_C| RP:PFM:REP 714->789|PF01483|4e-08|43.4|76/85|P_proprotein| HM:PFM:NREP 4 HM:PFM:REP 413->587|PF02868|2.6e-54|50.9|159/163|Peptidase_M4_C| HM:PFM:REP 262->410|PF01447|1.1e-29|41.5|142/151|Peptidase_M4| HM:PFM:REP 713->790|PF01483|8.9e-22|42.3|78/87|P_proprotein| HM:PFM:REP 125->167|PF07504|1.1e-17|53.5|43/51|FTP| GO:PFM:NREP 8 GO:PFM GO:0004222|"GO:metalloendopeptidase activity"|PF07504|IPR011096| GO:PFM GO:0008270|"GO:zinc ion binding"|PF07504|IPR011096| GO:PFM GO:0004222|"GO:metalloendopeptidase activity"|PF01447|IPR013856| GO:PFM GO:0004222|"GO:metalloendopeptidase activity"|PF02868|IPR001570| GO:PFM GO:0005576|"GO:extracellular region"|PF02868|IPR001570| GO:PFM GO:0006508|"GO:proteolysis"|PF02868|IPR001570| GO:PFM GO:0004252|"GO:serine-type endopeptidase activity"|PF01483|IPR002884| GO:PFM GO:0006508|"GO:proteolysis"|PF01483|IPR002884| RP:SCP:NREP 2 RP:SCP:REP 263->587|1bqbA|1e-71|35.9|287/301|d.92.1.2| RP:SCP:REP 687->790|1ot5A1|6e-24|23.1|104/139|b.18.1.20| HM:SCP:REP 255->588|8tlnE_|1.5e-76|44.2|310/0|d.92.1.2|1/1|Metalloproteases ("zincins"), catalytic domain| HM:SCP:REP 593->679|1u2cA1|9e-11|36.0|86/0|b.1.6.2|1/1|Cadherin-like| HM:SCP:REP 666->791|1ot5A1|6.8e-22|32.2|121/139|b.18.1.20|1/1|Galactose-binding domain-like| OP:NHOMO 402 OP:NHOMOORG 195 OP:PATTERN --------------------------------------------------2----------------- --1-2---------2------1----------1--------111--1--11-111-----212-212867-------------------------------1----1------------------------------11-----2--1-------------------111-----------------------1445456484555655-----2554-1--111-1111-1-222222212222222-12-11------------------------------------------------------------------------2-6566555-5--------------------------------------------------1-------------------------------------1---------------------------------------------------------------------------11-1111111-111-----1111-11--------------------1--------1----------------------------------1-------61-----------------------------1------1-1-42222311332122-1114--------------111------------------------------------1111--1--------------1------------------------1-----4444--41----------------------------1111---1-----1111-------------11111132133--21211-33------------34------------------------------------------------- ---------------------1--1-1---------------------211111-----111------------------------------------------------------------------------------------------------------1------------------------1--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 497 STR:RPRED 62.8 SQ:SECSTR ######################################################################################################################################################################################################################################################################EEEEEcTTccEEEEEEEEETTEEEcEEccccccEEEEEEcTTTccEEEcEEcccEEccGGGHTTTHHHHHHHHHHHHHHHHHHHHHccccTTcccccEEEEEcccEcTTcEEEccccEEEccccccccccGGGcHHHHHHHHHHHHHHHTTcccccHHHHHHHHHHHHHHHHHHcTTcTccHccccEEcTTTccTTcTTcccEEcccGGGGTccccGGGcccccHHHHHHTHHHHHHHHHHTTccEEEEEEcTTcEEEEEEEEEHHHHcHHHHHHHHHHHHHHTccTTccHHHHHHHHHHHHHHHTcHHHHHEEHHHHHHcccccccHHHHccEEEEEEEEETTTTEEEEEEEETTcccccEEccccEEEEEGGGcccccccccccGGGGTTcccEEEcccEEcccEEEEEcccTTcEEEEEEEEEEcccEEEEEEETTEEEEEEEEccccccccGGGccGGGcccccccccccEEEEEEEEEccccccTTccEEEE################################ DISOP:02AL 1-47, 68-81, 91-121, 196-207| PSIPRED cccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccEEEccccccccccEEccccccccHHHHHccccHHHHHHHHHHHHHHHHHHcccccccEEEEEEEEcccccEEEEEEEEEccEEEEccEEEEEEccccEEEEEEEEccccccccccccccHHHHHHHHHHHHHHHcccccEEcccEEEEEEEccccEEEEEEEEEEEEEccccccEEEEEEcccccHHHHcccccEEEcccccccccEEEEEEEEccEEEccccccccEEEEEccccccccccEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccEEEEEEEccccccEEEEcccEEEEEEccccccccccHHHHHEEEcccccEEcccccccccccccHHHHHHHHHHHHHHHHHHccccccccEEEccEEEccccccEEEEccccccccccccccccccccccEEEcccHHHHHHHHHHHcccccccccccccccEEccEEEccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccccccccccccccccccccccEEcccccccccccccEEEEEEEcccccEEEEEccccccccccccccEEEEEEEEcccccccEEEccccEEEEEccccccccccccccEEEEEEEEEEEccccccEEEEEEEEEcccccEEEEEEccccEEEEEEEccccccccEEEEEEEEEEcccccccEEEEEEEcccccccEEEEEEEcc //