[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68750.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.80.1
:95 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   11->76 1vm6D PDBj 4e-04 33.3 %
:RPS:PDB   1->74 2aagA PDBj 4e-07 10.8 %
:RPS:SCOP  1->66 1dptA  d.80.1.3 * 4e-06 23.0 %
:HMM:PFM   4->41 PF01361 * Tautomerase 2.3e-07 36.8 38/60  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68750.1 GT:GENE BAC68750.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1315062..1315349) GB:FROM 1315062 GB:TO 1315349 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68750.1 LENGTH 95 SQ:AASEQ MATSVTDLDVSALGKSTVRSTVLVNPVPADHYYVAGHPVREATGAHVEVSITAGTNNADEKARFIAGAYNGITQFDHYRHAPRPVATPDGRNRMP GT:EXON 1|1-95:0| BL:PDB:NREP 1 BL:PDB:REP 11->76|1vm6D|4e-04|33.3|66/217| RP:PDB:NREP 1 RP:PDB:REP 1->74|2aagA|4e-07|10.8|74/129| HM:PFM:NREP 1 HM:PFM:REP 4->41|PF01361|2.3e-07|36.8|38/60|Tautomerase| RP:SCP:NREP 1 RP:SCP:REP 1->66|1dptA|4e-06|23.0|61/117|d.80.1.3| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 76 STR:RPRED 80.0 SQ:SECSTR HHHHHHHHHHHHHcccTTcccEEEEEEcGGGcccccTTcccccTTcEEEEEEEccccHHHHHHHHHHHHHHHHHHH################### DISOP:02AL 1-3, 88-95| PSIPRED cccccccccHHHcccccccEEEEEcccccccEEEcccccccccccEEEEEEEEcccccccHHEEEHHcccccHHccccccccccccccccccccc //