[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68751.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:190 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  25->74 1utbA  c.94.1.1 * 4e-04 14.0 %
:HMM:SCOP  23->141 2esnA2 c.94.1.1 * 3.3e-09 23.5 %
:HMM:PFM   26->92 PF03466 * LysR_substrate 4.8e-11 31.3 67/209  
:HMM:PFM   95->155 PF03466 * LysR_substrate 1.8e-08 24.6 61/209  
:BLT:SWISS 101->146 MAUR_KLEPN 3e-04 37.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68751.1 GT:GENE BAC68751.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1315431..1316003 GB:FROM 1315431 GB:TO 1316003 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE PF03466: LysR substrate binding domain GB:PROTEIN_ID BAC68751.1 LENGTH 190 SQ:AASEQ MILPHAGSALAATDAICDAATRHDATTGGTVRLAADPTVRQGLLPSLPRHWSEHLPAIRVRVFEGSGEETETWLASAAADAAVVVDPPAGSGAQEYTPAHRVRDLGTLISMAQAGLGVSILPEVSRPLIPRDLVLVRVAPHHSRRLAPCGPRKRPWPPQCVLSWTPWPGFRRARPASCADLMAPTGTPLP GT:EXON 1|1-190:0| BL:SWS:NREP 1 BL:SWS:REP 101->146|MAUR_KLEPN|3e-04|37.0|46/100| SEG 9->21|alaatdaicdaat| SEG 75->93|asaaadaavvvdppagsga| HM:PFM:NREP 2 HM:PFM:REP 26->92|PF03466|4.8e-11|31.3|67/209|LysR_substrate| HM:PFM:REP 95->155|PF03466|1.8e-08|24.6|61/209|LysR_substrate| RP:SCP:NREP 1 RP:SCP:REP 25->74|1utbA|4e-04|14.0|50/214|c.94.1.1| HM:SCP:REP 23->141|2esnA2|3.3e-09|23.5|119/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------1--1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 188-190| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEHHHHHHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHcccccEEEEEccccccccccccccEEEEHHHHHHHHHHcccccEEccccccccccccEEEEEEccccccEEEEEEcccccccccEEEEEcccccccccccccHHHHccccccccc //