[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68752.1
DDBJ      :             putative membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:426 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  7->423 1pv7A_ f.38.1.2 * 1.7e-26 23.8 %
:HMM:PFM   32->364 PF07690 * MFS_1 1.1e-13 26.6 316/353  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68752.1 GT:GENE BAC68752.1 GT:PRODUCT putative membrane protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1316740..1318020) GB:FROM 1316740 GB:TO 1318020 GB:DIRECTION - GB:PRODUCT putative membrane protein GB:NOTE PF07690: Major Facilitator Superfamily GB:PROTEIN_ID BAC68752.1 LENGTH 426 SQ:AASEQ MTIQLYEDRPAGRHAAVPHGSLLRRVYAPRAFDALAFSMSTYAMPLLVLATTDSARLTGLAFALEWIPRVAAFGLAGDLVDRRGAAVVFFLASLARAIVVAAGAVALIMLQRGTAETVVVMALAAGTGTLTQFSFIANEAVGAIVSRRTDTQAHKVQAVLIGIDQTATLTGPALGGVLLLAGPTRMLVVLGVLSCLAAALALQTPPTPLRGSGRHNKRPEAGLKAGWRTLRSLPALGCLVAGLSISNLALGLLQSASPIIVVERFGLSPAAVGTLWSAAAASTLLAVAVCRFALGRLGLWGVGAVCSTIASAACLALAQAPTYLAYVVLMALFMAGDGGLTVVLRTLRSLLIPAAVFGSTLSLTILLLLLPFPVAGILVAVTPPWALGHVIAVCAALQAVALGIVFLRLRTDPVLRASGKPEQATA GT:EXON 1|1-426:0| TM:NTM 13 TM:REGION 29->51| TM:REGION 54->76| TM:REGION 85->107| TM:REGION 117->139| TM:REGION 156->178| TM:REGION 185->207| TM:REGION 230->252| TM:REGION 256->278| TM:REGION 281->303| TM:REGION 308->330| TM:REGION 335->357| TM:REGION 361->383| TM:REGION 387->408| SEG 91->107|laslaraivvaagaval| SEG 166->184|tatltgpalggvlllagpt| SEG 196->209|laaalalqtpptpl| SEG 277->289|saaaastllavav| SEG 310->320|asaaclalaqa| SEG 340->351|ltvvlrtlrsll| SEG 359->370|stlsltilllll| HM:PFM:NREP 1 HM:PFM:REP 32->364|PF07690|1.1e-13|26.6|316/353|MFS_1| HM:SCP:REP 7->423|1pv7A_|1.7e-26|23.8|403/417|f.38.1.2|1/1|MFS general substrate transporter| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 6-7, 207-221, 416-426| PSIPRED cEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEHHHHHHHHHHHHEEEEEcccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccc //