[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68755.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  105/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:224 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   95->198 PF09997 * DUF2238 2e-26 51.0 %
:HMM:PFM   59->199 PF09997 * DUF2238 1.7e-59 47.5 141/143  
:BLT:SWISS 45->220 YJDF_ECOLI 1e-35 42.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68755.1 GT:GENE BAC68755.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1321655..1322329) GB:FROM 1321655 GB:TO 1322329 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68755.1 LENGTH 224 SQ:AASEQ MPAVTTAASSRPADRLAVDRVVRRRLPVALLAVVTVALAMSAWHAKDPTTWLLETVWAWVGLPLVVLLRRRFPLTSLLYCLLAAHALVLAVGGHYTYAEVPAGDWVRDWLDLSRNPYDRFGHLMQGFVPAVLVREILTRTSPLRGSRWLAPLTVCACLAFSAVFELLEWAAAVAGGHAADAFLATQGDVWDTQWDMFCALIGAVCSLLLLSRAHDRRLARLDGR GT:EXON 1|1-224:0| BL:SWS:NREP 1 BL:SWS:REP 45->220|YJDF_ECOLI|1e-35|42.0|176/100| TM:NTM 4 TM:REGION 26->43| TM:REGION 61->83| TM:REGION 151->173| TM:REGION 194->215| SEG 11->39|rpadrlavdrvvrrrlpvallavvtvala| SEG 62->74|lplvvllrrrfpl| SEG 81->94|llaahalvlavggh| SEG 170->184|aaavagghaadafla| RP:PFM:NREP 1 RP:PFM:REP 95->198|PF09997|2e-26|51.0|104/143|DUF2238| HM:PFM:NREP 1 HM:PFM:REP 59->199|PF09997|1.7e-59|47.5|141/143|DUF2238| OP:NHOMO 110 OP:NHOMOORG 106 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1--------------------------------------1-----------------------------------------------------------------------------------1----------1-------------1---111---------------------------------------------------------------------------------------------------------1-------------------1-----------1------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------1----1----11-1-11-1-----------11----1-1----11----------11111--11------------------------1--1-1---1--1-1111112111111111111--------------2---1-111-111111-1111111111111111111---------1---------------1--1111-----------------2-----------1---------------------------21-------------1------------1---------11111-----------------------------------------------------------------------1- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 6-8, 222-224| PSIPRED ccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //