[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68756.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.118.1
:180 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  25->134 1u6gC  a.118.1.2 * 6e-05 12.7 %
:HMM:PFM   96->153 PF07506 * RepB 0.00097 25.5 51/185  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68756.1 GT:GENE BAC68756.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1322480..1323022) GB:FROM 1322480 GB:TO 1323022 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68756.1 LENGTH 180 SQ:AASEQ MRTGSTEQLSAERTGRTPSAGVEKATPLKALGRVPWQDIKDSSGSAAAIPLLLSSVAWGDAATARAALSDLRERICQYGFVVEQATAATVPFLWELAQLPQVSCRAQIIQLLRNIADARQWESTAALYPKLLNHRENPVVWERQARQAVRARRSVVEQLLAEDDAEITQATTELARALGA GT:EXON 1|1-180:0| SEG 139->158|vvwerqarqavrarrsvveq| HM:PFM:NREP 1 HM:PFM:REP 96->153|PF07506|0.00097|25.5|51/185|RepB| RP:SCP:NREP 1 RP:SCP:REP 25->134|1u6gC|6e-05|12.7|110/1146|a.118.1.2| OP:NHOMO 4 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------112----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-19| PSIPRED ccccccHHHHHHHcccccccccccccHHHHHHcccHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcc //