[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68757.1
DDBJ      :             putative regulatory protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  14/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:76 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   15->69 PF04149 * DUF397 5e-11 61.1 %
:HMM:PFM   15->69 PF04149 * DUF397 4.9e-24 50.0 54/56  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68757.1 GT:GENE BAC68757.1 GT:PRODUCT putative regulatory protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1323552..1323782 GB:FROM 1323552 GB:TO 1323782 GB:DIRECTION + GB:PRODUCT putative regulatory protein GB:NOTE PF04149: Domain of unknown function (DUF397) GB:PROTEIN_ID BAC68757.1 LENGTH 76 SQ:AASEQ MPTAPNGVQASSLAARWIKSRHSNAEGNCVEVAALDGGGIAMRNSRDPEGPALVYTSAEVAAFLAGAKDGEFDHLL GT:EXON 1|1-76:0| RP:PFM:NREP 1 RP:PFM:REP 15->69|PF04149|5e-11|61.1|54/55|DUF397| HM:PFM:NREP 1 HM:PFM:REP 15->69|PF04149|4.9e-24|50.0|54/56|DUF397| OP:NHOMO 41 OP:NHOMOORG 14 OP:PATTERN -------------------------------------------------------------------- ----4-------------------------------4----432----------------23--1225441---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 19-27| PSIPRED ccccccccccccccccEEEcccccccccEEEEEcccccEEEEEccccccccEEEEcHHHHHHHHHHHHcccccccc //