[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68759.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  22/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:272 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   11->270 2qe6A PDBj 1e-45 44.2 %
:RPS:PDB   57->235 3bgvC PDBj 3e-04 11.2 %
:RPS:SCOP  21->243 1suiA1  c.66.1.1 * 3e-05 10.7 %
:HMM:SCOP  16->263 1rjdA_ c.66.1.37 * 6.6e-42 32.1 %
:RPS:PFM   11->270 PF04672 * DUF574 2e-60 50.8 %
:HMM:PFM   6->271 PF04672 * DUF574 1.6e-100 45.0 262/268  
:BLT:SWISS 195->266 ASSY_LEIXX 3e-05 36.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68759.1 GT:GENE BAC68759.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1324945..1325763) GB:FROM 1324945 GB:TO 1325763 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF04672: Protein of unknown function (DUF574) GB:PROTEIN_ID BAC68759.1 LENGTH 272 SQ:AASEQ MQSGKQLSTSIDATVPTAARMYDHYLGGKDNYAADRAACEELDKVVPSTRPLAVNNRRFLRRVVGTLAAEYGIRQFLDHGSGLPTQDNVHQVAQRVDPTAHVVYVDNDPMVLVHGRALLEQDERTVVIQADMRDTEGIFSHPDTKRLIDFSEPVAALFVSVMHCLPDGDTDGPPALARRVAERLVPGSFMVMCQLVSEDAQIRDFVTDFMDRTTQGSWGRVRQEKDVVDLFQGMDILEPGLVDVSTWRPDSEVAPRQLTQEWIEFGGVGRIR GT:EXON 1|1-272:0| BL:SWS:NREP 1 BL:SWS:REP 195->266|ASSY_LEIXX|3e-05|36.2|69/478| BL:PDB:NREP 1 BL:PDB:REP 11->270|2qe6A|1e-45|44.2|249/259| RP:PDB:NREP 1 RP:PDB:REP 57->235|3bgvC|3e-04|11.2|178/270| RP:PFM:NREP 1 RP:PFM:REP 11->270|PF04672|2e-60|50.8|256/264|DUF574| HM:PFM:NREP 1 HM:PFM:REP 6->271|PF04672|1.6e-100|45.0|262/268|DUF574| RP:SCP:NREP 1 RP:SCP:REP 21->243|1suiA1|3e-05|10.7|206/227|c.66.1.1| HM:SCP:REP 16->263|1rjdA_|6.6e-42|32.1|237/0|c.66.1.37|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 160 OP:NHOMOORG 24 OP:PATTERN -------------------------------------------------------------------- ----H-------------------------------3----PCI----------------65--45JACA4------------------------------------------------------------------1111---1-----------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------11----------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 259 STR:RPRED 95.2 SQ:SECSTR ##########GccccccHHHHHHHHTTcccccHHHHHHHHHHHHc#TTHHHHHHHHHHHHHHHHHHHHHHHHcHTccccEEEETcTTTTTHHHHHHHTccEEEEEEccHHHHHHHHHHHHHHHTccccccEEEEEEccTTTcccTTTcccTccEEEEEEEccGGGGGGcHHHHHHHHHHHHTTEEEEEEEEEEEEcHHHHHHHHTTccccEEEcccEEEEEcccccccccccEEEEcTTccEEGGGccccccccTTcccGGGGcEEEEEE## DISOP:02AL 1-13| PSIPRED cccccccccccccccccEEEEEEccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccEEEEccccccccccHHHHHHHHccccEEEEEcccHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHHHHccccccHHHHHHHHHHHccccccccHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHHHHcccccEEEccHHHHHHHHcccccccccEEEcccccccccccccccccHHHHHHccEEcc //