[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68765.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  30/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.23.1d.110.2
:245 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   24->185 2dwkA PDBj 1e-14 21.1 %
:RPS:SCOP  25->207 1mc0A1  d.110.2.1 * 1e-10 11.1 %
:HMM:SCOP  39->192 1mc0A2 d.110.2.1 * 1.9e-19 31.1 %
:HMM:SCOP  169->238 1qo0D_ c.23.1.3 * 1e-09 28.6 %
:RPS:PFM   129->177 PF01590 * GAF 5e-05 40.8 %
:RPS:PFM   185->237 PF03861 * ANTAR 4e-08 54.7 %
:HMM:PFM   185->237 PF03861 * ANTAR 2.6e-22 50.9 53/56  
:HMM:PFM   92->177 PF01590 * GAF 4.9e-07 27.9 86/154  
:BLT:SWISS 23->66 BAI1_MOUSE 7e-04 47.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68765.1 GT:GENE BAC68765.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1332766..1333503) GB:FROM 1332766 GB:TO 1333503 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF03861: ANTAR domain GB:PROTEIN_ID BAC68765.1 LENGTH 245 SQ:AASEQ MSGPPPSGPSSADGTSDEAWPELADRLAVMARDLLAQESLQATVDRIAFHAVGLIEGCDVSGILTLSRKNVQTLTATDDVVRRSDAIQGELGEGPCFNAVTDEEPVQRIPDLRTAGDRWPRYAPQAAELGIRSAMGFRLFTRHHTLGALNLYSFRPNAFSERDEHLGWLLASHAAVAFAYARTEEQLQTALRSRDEIGQAIGIVMERFHLGQDEAFELLKKTSQDLNIKLRDVATKITPSDGTPG GT:EXON 1|1-245:0| BL:SWS:NREP 1 BL:SWS:REP 23->66|BAI1_MOUSE|7e-04|47.6|42/1582| SEG 2->11|sgpppsgpss| RP:PDB:NREP 1 RP:PDB:REP 24->185|2dwkA|1e-14|21.1|142/152| RP:PFM:NREP 2 RP:PFM:REP 129->177|PF01590|5e-05|40.8|49/143|GAF| RP:PFM:REP 185->237|PF03861|4e-08|54.7|53/56|ANTAR| HM:PFM:NREP 2 HM:PFM:REP 185->237|PF03861|2.6e-22|50.9|53/56|ANTAR| HM:PFM:REP 92->177|PF01590|4.9e-07|27.9|86/154|GAF| RP:SCP:NREP 1 RP:SCP:REP 25->207|1mc0A1|1e-10|11.1|180/187|d.110.2.1| HM:SCP:REP 39->192|1mc0A2|1.9e-19|31.1|151/0|d.110.2.1|1/1|GAF domain-like| HM:SCP:REP 169->238|1qo0D_|1e-09|28.6|70/0|c.23.1.3|1/1|CheY-like| OP:NHOMO 108 OP:NHOMOORG 30 OP:PATTERN -------------------------------------------------------------------- --1-----------144----4--12------45551465-3--8121--2-849-------1-5-5232----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 200 STR:RPRED 81.6 SQ:SECSTR #####################HHHHHHHHHHHHHHHHHHHHHHcccccTTcHHHHHHHHHHHHHHTTccTTEEEEEEEcccccTTHHHHHHHHHHcGGGHHHHHHHHTcTTcccHHHHHHHHHHHTccccccHHHHHHHHTcHHHHTTTEEEEccTTcGcHHHHHHHHHGGGGGGcccccccHHHcccHHHHHccccccHHHHHHHHHTccHHHHHHHHHH######################## DISOP:02AL 1-22, 184-194| PSIPRED ccccccccccccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccEEEEEEEcccEEEEEEccccHHHHHHHHHccccccccEEEEEcccEEEEEEcccccccccHHHHHHHHHcccEEEEEEEEEEcccEEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHcccccc //