[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68766.1
DDBJ      :             putative MarR-family transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:147 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   22->137 2nyxB PDBj 7e-06 31.6 %
:RPS:PDB   8->134 3bpxB PDBj 5e-11 18.5 %
:RPS:SCOP  6->134 2a61A1  a.4.5.28 * 1e-10 19.0 %
:HMM:SCOP  1->141 1jgsA_ a.4.5.28 * 2e-19 25.0 %
:HMM:PFM   48->83 PF09339 * HTH_IclR 3.9e-08 38.9 36/52  
:BLT:SWISS 38->134 Y2034_MYCBO 4e-08 29.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68766.1 GT:GENE BAC68766.1 GT:PRODUCT putative MarR-family transcriptional regulator GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1333655..1334098) GB:FROM 1333655 GB:TO 1334098 GB:DIRECTION - GB:PRODUCT putative MarR-family transcriptional regulator GB:NOTE PF01047: MarR family GB:PROTEIN_ID BAC68766.1 LENGTH 147 SQ:AASEQ MTGPAKNLPQLFLEAKRWFDDALLASMRAAGEQPVSIAQGAVFAVLDDEGTSISELARRIGITRQTAHQAVHGLIGMGLLEQVSDPASARSSLVRTTAEGTRVHQRAQTALALIEQVLADRIGADAATALRRALSEPWGQPPSVEAP GT:EXON 1|1-147:0| BL:SWS:NREP 1 BL:SWS:REP 38->134|Y2034_MYCBO|4e-08|29.9|97/143| BL:PDB:NREP 1 BL:PDB:REP 22->137|2nyxB|7e-06|31.6|114/145| RP:PDB:NREP 1 RP:PDB:REP 8->134|3bpxB|5e-11|18.5|124/138| HM:PFM:NREP 1 HM:PFM:REP 48->83|PF09339|3.9e-08|38.9|36/52|HTH_IclR| RP:SCP:NREP 1 RP:SCP:REP 6->134|2a61A1|1e-10|19.0|126/139|a.4.5.28| HM:SCP:REP 1->141|1jgsA_|2e-19|25.0|136/0|a.4.5.28|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 12 OP:NHOMOORG 12 OP:PATTERN -------------------------------------------------------------------- ----1----------1-----1----------1---------------------------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1------------------------------1----1------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 141 STR:RPRED 95.9 SQ:SECSTR ##cHHHHHHHHHHHHHHHHHHHHHHHHGGGTGGTccHHHHHHHHHHHHcTTcHHHHHHHHTccHHHHHHHHHHHHHTTcEEEEEETTEEEEEEEEEcHHHHHHHHHHHHHHHHHHHHHTTTccHHHHHHHHHHHHHHHHTccc#### DISOP:02AL 141-147| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEccccccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccccc //