[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68767.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.35.1
:145 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   22->65 2a63A PDBj 3e-07 11.4 %
:RPS:SCOP  15->77 2ox6A1  a.35.1.6 * 6e-07 20.6 %
:HMM:SCOP  14->129 1s4kA_ a.35.1.6 * 5.5e-28 31.3 %
:HMM:PFM   16->108 PF08965 * DUF1870 1.7e-06 28.0 93/118  
:BLT:SWISS 14->68 YPE1_RHORU 5e-04 44.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68767.1 GT:GENE BAC68767.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1334264..1334701) GB:FROM 1334264 GB:TO 1334701 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68767.1 LENGTH 145 SQ:AASEQ MTQNRNVDGVPEGRGMTPAEFRVVREFLGLTGGWLAEHVGVSPNTVERWEQGEERIPAAVRGALGDLGRLTGEFVAEVVNSLVDLPEPGIVTYRDDAEYHAAHPESGYPAAWHRAVVARVAQEIPGLSIAYASDVVSEDVKVSAE GT:EXON 1|1-145:0| BL:SWS:NREP 1 BL:SWS:REP 14->68|YPE1_RHORU|5e-04|44.4|54/100| SEG 114->121|ravvarva| RP:PDB:NREP 1 RP:PDB:REP 22->65|2a63A|3e-07|11.4|44/66| HM:PFM:NREP 1 HM:PFM:REP 16->108|PF08965|1.7e-06|28.0|93/118|DUF1870| RP:SCP:NREP 1 RP:SCP:REP 15->77|2ox6A1|6e-07|20.6|63/162|a.35.1.6| HM:SCP:REP 14->129|1s4kA_|5.5e-28|31.3|115/0|a.35.1.6|1/1|lambda repressor-like DNA-binding domains| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 88 STR:RPRED 60.7 SQ:SECSTR ##########cccccccHHHHEHHHHHHHTcHHHHHHHHTccHHHHHHHHHTTccEEEEEcccccHHTccHHHHHHHHHHHHHHHHHTcHHHHHTTcc############################################### DISOP:02AL 1-9, 143-145| PSIPRED ccccccccccccccccccHHHHHHHHHHcccHHHHHHHHcccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEccccEEcccccccccHHHHHHHHHHHHHHccccEEHHHHHHHHccEEEccc //