[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68773.1
DDBJ      :             putative membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:95 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68773.1 GT:GENE BAC68773.1 GT:PRODUCT putative membrane protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1341421..1341708) GB:FROM 1341421 GB:TO 1341708 GB:DIRECTION - GB:PRODUCT putative membrane protein GB:NOTE PF07673: Protein of unknown function (DUF1602) GB:PROTEIN_ID BAC68773.1 LENGTH 95 SQ:AASEQ MTSYGSPSTASSGSRTNGLAIASLICGIVGVFFLSVILGPIAIVLGVVALRQAGGKGGGGMAKAGVVLGIVDLILFAVFMAVAASNGGFAWYVGG GT:EXON 1|1-95:0| TM:NTM 2 TM:REGION 24->46| TM:REGION 62->84| SEG 2->14|tsygspstassgs| SEG 53->65|aggkggggmakag| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-17, 56-58| PSIPRED cccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEcc //