Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68776.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:189 amino acids

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68776.1 GT:GENE BAC68776.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1344973..1345542 GB:FROM 1344973 GB:TO 1345542 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68776.1 LENGTH 189 SQ:AASEQ MRVRGHQVLILTCAAALLGATAACGGAGTATKRPGTARTAPSHARFDAEISLPDGRRVGMYYATGRGLVEQHRGTGSAAWSTPHLLHRTTSDPCQSLRLKAFGTTVAAIANWGVYCADGEPPTESLAAVGTGNLSEWDTDVTPDFDGWDAVKASEETGELSFTNGSVESVTRLRWRRTEGFSDVEEIPR GT:EXON 1|1-189:0| TM:NTM 1 TM:REGION 4->26| SEG 11->31|ltcaaallgataacggagtat| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 183-184| PSIPRED ccccccEEHHHHHHHHHHHHHHcccccccccccccccccccccccEEEEEEcccccEEEEEEEccccHHHHHcccccccccccHHEEcccccHHHHHHHHHHHHHHHHHHcccEEEccccccHHHHHEcccccccccccccccccccccccccccccccEEEccccHHHHHHHHHHHcccccHHHHccc //