[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68778.1
DDBJ      :             putative TetR-family transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  119/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.121.1a.4.1
:185 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->123 2fd5A PDBj 3e-13 41.1 %
:RPS:PDB   3->128 3e7qB PDBj 7e-11 16.9 %
:RPS:SCOP  6->70 2o7tA1  a.4.1.9 * 7e-12 20.0 %
:RPS:SCOP  84->183 2fd5A2  a.121.1.1 * 3e-10 31.0 %
:HMM:SCOP  1->81 1rktA1 a.4.1.9 * 6.7e-14 30.9 %
:HMM:SCOP  83->184 2fd5A2 a.121.1.1 * 9.3e-24 49.0 %
:RPS:PFM   16->60 PF00440 * TetR_N 6e-05 42.2 %
:HMM:PFM   17->61 PF00440 * TetR_N 3.5e-15 31.1 45/47  
:BLT:SWISS 4->118 YDHM_ECOLI 1e-09 27.0 %
:PROS 80->88|PS00177|TOPOISOMERASE_II
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68778.1 GT:GENE BAC68778.1 GT:PRODUCT putative TetR-family transcriptional regulator GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1346651..1347208 GB:FROM 1346651 GB:TO 1347208 GB:DIRECTION + GB:PRODUCT putative TetR-family transcriptional regulator GB:NOTE PF00440: Bacterial regulatory proteins, tetR family GB:PROTEIN_ID BAC68778.1 LENGTH 185 SQ:AASEQ MGRVSKEQARENRQRVVATASRLMRQQGTDGVSVADLMKAAGLTHGGFYKQFASKEALIDEATAHAFGTVEEQLGDGLQAHEGDSAAARTAFIDHYLSPEHRDDMADGCPTAALAADMARGPEESAAHETYVEGVRRFAARLAGADDDGLARLSTLVGALVLARAVKDDPLSDDLLEAARRQLLP GT:EXON 1|1-185:0| BL:SWS:NREP 1 BL:SWS:REP 4->118|YDHM_ECOLI|1e-09|27.0|115/199| PROS 80->88|PS00177|TOPOISOMERASE_II|PDOC00160| SEG 139->153|aarlagadddglarl| BL:PDB:NREP 1 BL:PDB:REP 7->123|2fd5A|3e-13|41.1|112/180| RP:PDB:NREP 1 RP:PDB:REP 3->128|3e7qB|7e-11|16.9|124/210| RP:PFM:NREP 1 RP:PFM:REP 16->60|PF00440|6e-05|42.2|45/47|TetR_N| HM:PFM:NREP 1 HM:PFM:REP 17->61|PF00440|3.5e-15|31.1|45/47|TetR_N| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00440|IPR001647| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00440|IPR001647| RP:SCP:NREP 2 RP:SCP:REP 6->70|2o7tA1|7e-12|20.0|65/78|a.4.1.9| RP:SCP:REP 84->183|2fd5A2|3e-10|31.0|100/104|a.121.1.1| HM:SCP:REP 1->81|1rktA1|6.7e-14|30.9|81/0|a.4.1.9|1/1|Homeodomain-like| HM:SCP:REP 83->184|2fd5A2|9.3e-24|49.0|102/0|a.121.1.1|1/1|Tetracyclin repressor-like, C-terminal domain| OP:NHOMO 193 OP:NHOMOORG 120 OP:PATTERN -------------------------------------------------------------------- 121-1-----------1--------1----------12--------------1-----------1--21--------------------------------------------------------------------11-1------------------------------------------1-------------------------------------1---------11--------------------------------------------------------------------------------------------------------------------------------------------1--6--------11223---11111------------1111-121-2--4221442334-22------1------1---------------------------------------------------1----211112-------23------2-21322-----11-2111-12--2---111------------1-----------------------------------------------------------------12--------1------------------------------2-1----------------------------------1--------------------1---------1--------------------------1-1---------------111111----1-3323233232122-223-------------------------1-1-11----------------------------------------------------------------1- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 184 STR:RPRED 99.5 SQ:SECSTR #HccccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHTccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHTccccHHHHHHHHHHHHTHHcHHHHcGGGHHHHHHHHHHHTTcHHHHHHHHHHHHTHHHHTTTcTTHHHHHHHHHHHHHHHHHHHHHTcHHHHHHHHHHHHHHHHc DISOP:02AL 1-15| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHccccccHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcc //