[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68783.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  15/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:126 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   9->78 PF07681 * DoxX 3.6e-07 22.9 70/85  
:HMM:PFM   53->121 PF02600 * DsbB 0.00031 23.2 69/156  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68783.1 GT:GENE BAC68783.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1352542..1352922 GB:FROM 1352542 GB:TO 1352922 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE PF07681: DoxX GB:PROTEIN_ID BAC68783.1 LENGTH 126 SQ:AASEQ MSRSERSSLLLAGLLATAGVAHFAAPRQFDATIPRALPGKPRTWTYASGIAELALAAGVALPRTRRAAALATAAFFVGVFPANVQMAVDWRHRPAPLRTAALARLPLQVPLVLWARGVAKGAEGRS GT:EXON 1|1-126:0| TM:NTM 3 TM:REGION 9->31| TM:REGION 45->63| TM:REGION 67->87| SEG 9->21|lllagllatagva| SEG 60->74|alprtrraaalataa| SEG 91->107|rhrpaplrtaalarlpl| HM:PFM:NREP 2 HM:PFM:REP 9->78|PF07681|3.6e-07|22.9|70/85|DoxX| HM:PFM:REP 53->121|PF02600|0.00031|23.2|69/156|DsbB| OP:NHOMO 15 OP:NHOMOORG 15 OP:PATTERN -------------------------------------------------------------------- ----1------1--111----1---1------1----111---------------1-----------111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 122-126| PSIPRED cccHHHHHHHHHHHHHHHHHHHHccHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHcccHHHHHHHHHHHHHcccccc //