[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68785.1
DDBJ      :             putative secreted protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  64/915 : Eukaryota  30/199 : Viruses  0/175   --->[See Alignment]
c.23.10
:427 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   341->414 3bzwF PDBj 1e-04 38.2 %
:RPS:PDB   220->415 3bzwF PDBj 1e-23 24.2 %
:RPS:SCOP  220->409 1yzfA1  c.23.10.5 * 7e-22 21.6 %
:HMM:SCOP  215->414 1deoA_ c.23.10.4 * 7.2e-29 33.0 %
:HMM:PFM   217->409 PF00657 * Lipase_GDSL 2.1e-17 21.6 190/235  
:HMM:PFM   23->97 PF00922 * Phosphoprotein 0.00065 22.2 72/283  
:BLT:SWISS 92->147 ERB1_MAGGR 3e-04 39.3 %
:PROS 388->401|PS00761|SPASE_I_3
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68785.1 GT:GENE BAC68785.1 GT:PRODUCT putative secreted protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1353464..1354747) GB:FROM 1353464 GB:TO 1354747 GB:DIRECTION - GB:PRODUCT putative secreted protein GB:NOTE PF00657: GDSL-like Lipase/Acylhydrolase GB:PROTEIN_ID BAC68785.1 LENGTH 427 SQ:AASEQ MSAASYRRRAAGVVSAVILAVCGPLTVSSSAQTQAQAPTGTAGTPAAAQSKHSVVTWGASADRQSAGPADRSYRLIVRTSVGGTNMRIRLSNAFGDHPVTFANAYAGLRKQGAELVHGSNRKLSFDGAASVTVPAGETVLSDPLPGKLAAQSDLVVSLYVTGAQGPTTGHGMAMQTNYATAGDHAAEEGAANWTDPMGSWYWLDAVDVETSTAVSSVVALGDSITDGWASTTDGNRRWPDYLARRLQAASGSTVKGVANEGISGNKVLADGAGEAALKRLQRDVLSQPGVSTVFLFEGINDIKAHSGVTVEDMIAGYQEIIDRAHTAGKCVVGATVMPFKGWYEYDDASEAVRQGVNDWIRNSGALDAVTDFDKITRSPYDQQRILPFFDGGDHLHPNDKGMQAMADAVDLKALGCRATGGTQAARG GT:EXON 1|1-427:0| BL:SWS:NREP 1 BL:SWS:REP 92->147|ERB1_MAGGR|3e-04|39.3|56/100| PROS 388->401|PS00761|SPASE_I_3|PDOC00418| SEG 28->50|sssaqtqaqaptgtagtpaaaqs| SEG 205->219|avdvetstavssvva| BL:PDB:NREP 1 BL:PDB:REP 341->414|3bzwF|1e-04|38.2|68/235| RP:PDB:NREP 1 RP:PDB:REP 220->415|3bzwF|1e-23|24.2|178/235| HM:PFM:NREP 2 HM:PFM:REP 217->409|PF00657|2.1e-17|21.6|190/235|Lipase_GDSL| HM:PFM:REP 23->97|PF00922|0.00065|22.2|72/283|Phosphoprotein| RP:SCP:NREP 1 RP:SCP:REP 220->409|1yzfA1|7e-22|21.6|176/195|c.23.10.5| HM:SCP:REP 215->414|1deoA_|7.2e-29|33.0|182/233|c.23.10.4|1/1|SGNH hydrolase| OP:NHOMO 124 OP:NHOMOORG 94 OP:PATTERN -------------------------------------------------------------------- 313-5-------------------------------------------------------11--21-722-------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------2111---------------------------------------1---------------------------------------1---------------------------------------------111111111121122111111111--1-----------1---1---------------------------------------------------12--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111-----1-11-11------------------------------------22-1-11----------------------------------------------------------------1- ---------------11211111111-----------------------2121111122111---------------------------1--11-------------------------------------------------------------------------------------------1---2----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 233 STR:RPRED 54.6 SQ:SECSTR ######################################################################################################################################################################################cGGGccccccccccccHHHHHHHHHHHHHHHccccEEEEcTTTcccTTGcGccccHHHHHHHHHccEHTTcEEcEEEcccTTccGGGccccGGHHHHHHHHHHHHTTTccEEEEEcHHHHEEEEEccTTcHHHHHHHHHHHHHHHcTTcEEEEEcccEccTTcEEccTTcccTTcccHHHHHHHccEEcHHHHTccTcGGGGGGEEETTTEEEEEcHHHHHHHHHHHHGGGcc############ DISOP:02AL 1-4, 422-427| PSIPRED ccHHHHHHHHHHHHHHHHHHHccccccccccHHHHccccccccccccccccccEEEcccccccccccccccEEEEEEEEcccccEEEEEEEEccccccEEEEEEEEEEEcccccccccccEEEEEcccEEEEEccccEEEEccccccccccccEEEEEEcccccccEEEccccEEEEEEcccccccccccccccccccHHHEEHHHHccccccccEEEEEEcccccccccccccccccHHHHHHHHHHHccccEEEEEEEcccccEEEcccccHHHHHHHHHHHHHcccccEEEEEEccccccccccccHHHHHHHHHHHHHHHHHcccEEEEEEcccccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccHHHHHHHHcccccccccHHHHHHHHHHccHHHHHHccccccccccc //