[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68788.1
DDBJ      :             putative multiple sugar ABC transporter permease protein
Swiss-Prot:             

Homologs  Archaea  28/68 : Bacteria  552/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:273 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   137->273 2r6gG PDBj 9e-13 36.0 %
:RPS:PDB   161->198 3dhwA PDBj 2e-08 28.9 %
:RPS:SCOP  19->273 2r6gG1  f.58.1.1 * 4e-22 19.2 %
:HMM:PFM   79->261 PF00528 * BPD_transp_1 1.4e-16 18.9 169/185  
:BLT:SWISS 12->273 YURM_BACSU 3e-27 28.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68788.1 GT:GENE BAC68788.1 GT:PRODUCT putative multiple sugar ABC transporter permease protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1359193..1360014) GB:FROM 1359193 GB:TO 1360014 GB:DIRECTION - GB:PRODUCT putative multiple sugar ABC transporter permease protein GB:NOTE malG, PF00528: Binding-protein-dependent transport system inner membrane component GB:PROTEIN_ID BAC68788.1 LENGTH 273 SQ:AASEQ MLGGIALLWLVPLLWAMYTSLRPYSDTAKHGYLSWPHSLGFDNFTDAWDQSGMPHFFWNSVLITVPSVLFTLLFSSAVAFFVSRFDFRWNIVLLMLFTAGNLLPAQVLVTPLYRLYLLVPLPQWMSDSLLLYNSAWGIIAIHIAYQSGFCTFLLSNYMKTIPKEISEAALVDGAPVWRQFFQIILPLCRPAFAALATLESIWIYNDFFWPLALIETGDKRPVTSALANLQGAYFTNPNLIAAGALMTAIPTLLVYFALQRQFISGLTIGSGKG GT:EXON 1|1-273:0| BL:SWS:NREP 1 BL:SWS:REP 12->273|YURM_BACSU|3e-27|28.4|250/300| TM:NTM 4 TM:REGION 1->23| TM:REGION 59->81| TM:REGION 97->119| TM:REGION 136->158| SEG 74->88|fssavaffvsrfdfr| SEG 107->122|vlvtplyrlyllvplp| BL:PDB:NREP 1 BL:PDB:REP 137->273|2r6gG|9e-13|36.0|125/284| RP:PDB:NREP 1 RP:PDB:REP 161->198|3dhwA|2e-08|28.9|38/203| HM:PFM:NREP 1 HM:PFM:REP 79->261|PF00528|1.4e-16|18.9|169/185|BPD_transp_1| RP:SCP:NREP 1 RP:SCP:REP 19->273|2r6gG1|4e-22|19.2|250/284|f.58.1.1| OP:NHOMO 2701 OP:NHOMOORG 583 OP:PATTERN 11--2--11222122-612121--5--5--2-----------------------1131--1222---- ----b112223-1-23344-413346444443133312255226F*S2DCA2KFI11A--7578E4AITF47666DC91---4-------------------------1---------------------------89955---7311-311-11221-12212221222--1-----1----CB233BE-953222222331132223PF884822343928446676669*111111111111111-1---4411111-21222--11---1-32322324233422566677755564333344443333244---4442C4-1A1111121413A2--1444P-26231D--231--1I--1876H1-1-------1----2-A761--213313355355455B---5--3--8J--TRRGVSPfdXSP22---7C67557B64--------1111--11-----------------------------1---2-133326666664122233783332225551112--1124-122224577-------3--------------1-1--1-1--11111---------321314----------1------------------125-------5----------------------1---------26761413333333333-33333334333323333325656611123222222222222226-113332--477777777878---------11111-75C111111-----1--1------------11111222211113434----------1222222223143311111111111111--------------------3---------111-1111----1---5GEA69Q8A9-2- --------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------1--------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 125 STR:RPRED 45.8 SQ:SECSTR ########################################################################################################################################TTTHHHH########HHHHHHHTTccTTTTTHHHHHTccTHHHHHHTTHHHHHHHHHHHHHHHHHHHHTcc##HHHHHHcccGGGccHHHHGGG##GcccccccHHHHHHTHHHHHHHHHHHTTTccccccTTTccc PSIPRED cHHHHHHHHHHHHHHHHHHHHccHHHHHccccccccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc //