[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68789.1
DDBJ      :             putative multiple sugar ABC transporter permease protein
Swiss-Prot:             

Homologs  Archaea  33/68 : Bacteria  513/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:317 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   40->261 3fh6F PDBj 2e-08 22.2 %
:RPS:PDB   207->245 3dhwA PDBj 7e-07 27.0 %
:RPS:SCOP  76->272 2r6gF2  f.58.1.1 * 1e-19 21.9 %
:HMM:PFM   108->312 PF00528 * BPD_transp_1 7.3e-24 23.9 176/185  
:BLT:SWISS 40->263 YESP_BACSU 1e-28 31.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68789.1 GT:GENE BAC68789.1 GT:PRODUCT putative multiple sugar ABC transporter permease protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1360116..1361069) GB:FROM 1360116 GB:TO 1361069 GB:DIRECTION - GB:PRODUCT putative multiple sugar ABC transporter permease protein GB:NOTE malF, PF00528: Binding-protein-dependent transport system inner membrane component GB:PROTEIN_ID BAC68789.1 LENGTH 317 SQ:AASEQ MSSAPSVSSAPASPAPRKARPRRLGPGDRIFLTVIIGIPLAALLFFVWLPALASLWLSFTTWDGIDLVDIHWVGLDNYQEIFTNYPPFWPAVRHNVAWLLFTALLPTPFGIFLAYQLDRKIRFTRVYQTAIFLPMVLSLAVVGFIWEIIYNPDTGLLNGLLNAAGSGHHIDWLGNPDLNLWAVLVASGWRHTGYIMILYLAGLKGFDPALKEAAALDGANGRQTFLRVVFPALRPVNVIILVITVMESLRSFDVVYVLGGGIGSKPGMELLSLLITDNILGESSHIGYGSALAVVLLVVSLAAIGTFLVQNFRKEDQ GT:EXON 1|1-317:0| BL:SWS:NREP 1 BL:SWS:REP 40->263|YESP_BACSU|1e-28|31.4|220/309| TM:NTM 5 TM:REGION 32->54| TM:REGION 96->118| TM:REGION 127->149| TM:REGION 232->254| TM:REGION 279->301| SEG 2->23|ssapsvssapaspaprkarprr| SEG 155->167|gllngllnaagsg| SEG 290->303|salavvllvvslaa| BL:PDB:NREP 1 BL:PDB:REP 40->261|3fh6F|2e-08|22.2|221/316| RP:PDB:NREP 1 RP:PDB:REP 207->245|3dhwA|7e-07|27.0|37/203| HM:PFM:NREP 1 HM:PFM:REP 108->312|PF00528|7.3e-24|23.9|176/185|BPD_transp_1| RP:SCP:NREP 1 RP:SCP:REP 76->272|2r6gF2|1e-19|21.9|196/244|f.58.1.1| OP:NHOMO 2711 OP:NHOMOORG 548 OP:PATTERN 11--31112322223-313111--6--41-2-----------------------1341111421---- ---1e213334-1123344-413348444444144413575325J*U2ABC4LGI116--8677F3CIQE57444DA71---3-----------------------------------------------------79977---75221311-11221111222221333--1-----1----DA255BD-943222222331132223QG774622343B29347677669*1---------------1---531-12--11122--11-----32232324333422566677755563333333333333333---3333F4-3A1111121514B2--1334T-25222A--231--1I---665G2-1-------111111-DA91--535535656566666D---6--3-18O--WRRGXWOihZVS11---7B86556C85--------3--1--12-----------------------------2---1-132326887765133344884443335561123--2237-122124568-------3--------------1-1-------11111---------221213----------1--------------------4-------5----------------------1---------1455-312222222222-222222232222122222134355--112111111111111114-212222--366666666666---------11111-64C---------------------------11111122222231334-------------------3-33311111111111111-------------------12-------------111----11---5JEA7AN8B9-2- --------------------------------------------------------------------------------------------------------------------------------------------------------------2-----------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 221 STR:RPRED 69.7 SQ:SECSTR #######################################HHHHHHHTHHHHHHHHTTccccccccccccHHHHHHTTTHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTcccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHcccccc#ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccTTTTTHHHHHTccTHHHHHHTTHHHHHHHHHHHHHHHHHHHHTcHHHHHHHccc######################################################## DISOP:02AL 1-28, 315-317| PSIPRED cccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEcHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEEcccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //