[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68791.1
DDBJ      :             putative ROK-family transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  452/915 : Eukaryota  43/199 : Viruses  0/175   --->[See Alignment]
a.4.5c.55.1
:392 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   17->334 1z05A PDBj 6e-28 26.6 %
:RPS:PDB   18->280 1bg3A PDBj 1e-25 10.5 %
:RPS:SCOP  25->72 2hoeA1  a.4.5.63 * 4e-06 27.1 %
:RPS:SCOP  86->209 1z05A3  c.55.1.10 * 2e-18 25.8 %
:RPS:SCOP  212->386 2gupA2  c.55.1.10 * 2e-17 14.7 %
:HMM:SCOP  11->82 1z6rA1 a.4.5.63 * 8.6e-10 31.4 %
:HMM:SCOP  84->386 1sz2A1 c.55.1.7 * 3.8e-47 34.0 %
:RPS:PFM   18->55 PF08221 * HTH_9 5e-04 47.4 %
:RPS:PFM   90->274 PF00480 * ROK 3e-28 40.9 %
:HMM:PFM   90->274 PF00480 * ROK 1.5e-43 34.6 179/179  
:HMM:PFM   20->63 PF01047 * MarR 5.9e-07 27.3 44/59  
:BLT:SWISS 17->335 NAGC_SHIFL 8e-29 26.3 %
:PROS 220->247|PS01125|ROK
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68791.1 GT:GENE BAC68791.1 GT:PRODUCT putative ROK-family transcriptional regulator GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1362458..1363636) GB:FROM 1362458 GB:TO 1363636 GB:DIRECTION - GB:PRODUCT putative ROK-family transcriptional regulator GB:NOTE PF00480: ROK family GB:PROTEIN_ID BAC68791.1 LENGTH 392 SQ:AASEQ MRSTSRTEAFPAHTPAAAQIFTTVLSHGPLTRSEIAGRTRLSAAAVTKAVRPLIEAGYLVEDADDDARQPSLGRPANPVQVDGGRALFIGVKVTGDELIAVLTDLCCRIRVARHLPLTSRDPGAVLASITALVQELLTEADGFGVAVHGLGIAVSGDVDRAAGVVRYSPFLEWSDVPLAELASLATGLPVTVDNDVRALTVAEQWFGAGVGLSDFAVVTVGAGIGCGLVVHGHVVSGAHGVAGEIGHVAIDPAGPPCHCGNRGCVEAIAADSAIVGRIREVTGIEVADTAEAVDLAHAGNPGAREVYARAGDAIGRGIATVANLLGPERVIISGEGLAAYDLFAEQIREAFAAAAFGSAARCDLQTRPLPFEEWARGAAATAIQSFIRSDTY GT:EXON 1|1-392:0| BL:SWS:NREP 1 BL:SWS:REP 17->335|NAGC_SHIFL|8e-29|26.3|316/406| PROS 220->247|PS01125|ROK|PDOC00866| SEG 223->243|gigcglvvhghvvsgahgvag| SEG 308->319|aragdaigrgia| SEG 350->360|afaaaafgsaa| BL:PDB:NREP 1 BL:PDB:REP 17->334|1z05A|6e-28|26.6|316/396| RP:PDB:NREP 1 RP:PDB:REP 18->280|1bg3A|1e-25|10.5|258/902| RP:PFM:NREP 2 RP:PFM:REP 18->55|PF08221|5e-04|47.4|38/62|HTH_9| RP:PFM:REP 90->274|PF00480|3e-28|40.9|181/181|ROK| HM:PFM:NREP 2 HM:PFM:REP 90->274|PF00480|1.5e-43|34.6|179/179|ROK| HM:PFM:REP 20->63|PF01047|5.9e-07|27.3|44/59|MarR| RP:SCP:NREP 3 RP:SCP:REP 25->72|2hoeA1|4e-06|27.1|48/58|a.4.5.63| RP:SCP:REP 86->209|1z05A3|2e-18|25.8|124/128|c.55.1.10| RP:SCP:REP 212->386|2gupA2|2e-17|14.7|170/175|c.55.1.10| HM:SCP:REP 11->82|1z6rA1|8.6e-10|31.4|70/0|a.4.5.63|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 84->386|1sz2A1|3.8e-47|34.0|288/0|c.55.1.7|1/1|Actin-like ATPase domain| OP:NHOMO 1020 OP:NHOMOORG 501 OP:PATTERN ----------------1-----------------------------1--------------111--1- 223-E1111111-1-1111-13---311111-2---33763224885173327461-6--2373868FG9422223441-112-11-12232-2-1----1----112----------------1------1---2-11431114-1111111---11111-111112221------------121--44-212111111321111111243322111222-32133332154--------------------1-1-11-1---1111111-1-111111111222111111222221221111111111111212111322121--211111111113-11-1111121-211--11--1-5-1265521-1111211------1------------11111111111-11111---26--A3365527A743-----12-1111111--------1------------------------------------------------------------11--------1---------1--------21-------1-----------------------------11211111-111111-----------------------------221-------1--------------------------------32222223333333333-3333333333333333332332222222222222222222222432322323-233333313333----------------1-----1---------1--------------------------11-1---------22232222222222--11111-------------1111------------------------------------1331123333--1 --------------------------------------------------------------------------------------------------------------3111121111--11321113A1-114--11111111-11-111111111------------------------------------1--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 391 STR:RPRED 99.7 SQ:SECSTR GGGHHHHHHHHTccHHHHHHHHHHHHHHHHHHHHHTGGGcccHHHHHHHHHHHHHHHHHcTTTGGGcccccEEcccccccccccccEEEEEEEccccEEEEEEEcccEEEccEEcccTTTTTccHHHHHHHHHHHHHHHHHHHTccccccEEEEEEcccEEcccTTccEEcccTTccHHHHHHHHHHHHTccccEEEEEHHHHHHHHHHHcTTEEEEEEEcccEEEEEEEEGGGcTTccccccEEEEcccccEccGGGTTTTTTTTTTccHHHHHHHHTcTTTTccccHHHHHHHHHHTcHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcGGGGGHHHHHHHHHHHHHHccHHHHTTccEEEccccTTcGGGGHHHHHHHHHHcccE# DISOP:02AL 1-18, 62-76, 391-392| PSIPRED cccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEcccccccccccccEEEEEEccccEEEEEEEEcccEEEEEEEcccccEEEEEEEEcccccHHHHHHHHHHHHHHHHHHcccccccEEEEEEEcccEEEccccEEEEccccccccccHHHHHHHHHcccEEEEccHHHHHHHHHHHcccccccEEEEEEEcccccEEEEEccEEEccccccccccEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHHHHHHHHHHHccccccccEEEEcccccHHHHHHHHHHHHHHHccccc //