[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68794.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  20/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:194 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   42->161 PF09348 * DUF1990 1e-11 39.3 %
:HMM:PFM   23->188 PF09348 * DUF1990 1.4e-50 45.9 157/158  
:BLT:SWISS 15->161 Y2035_DEIRA 3e-07 34.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68794.1 GT:GENE BAC68794.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1367063..1367647 GB:FROM 1367063 GB:TO 1367647 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68794.1 LENGTH 194 SQ:AASEQ MPPHSPSDLPRAPGPPPAEALSYGPAGATCPGDESWHADGEGYRRYDRTVVIGHGDAHWRAAADAVLHWGIKRRSGFRVTPRSGAGERVTEGAEYRITAAIGPLAVHEPVRVVAVVVTPERCGFAYGTLPGHPVSGEEAFVVHRTPDGAVALTLRSLTRPAPSGPWRALFPLLLVAQRFYRRRYLRSLRAVAPR GT:EXON 1|1-194:0| BL:SWS:NREP 1 BL:SWS:REP 15->161|Y2035_DEIRA|3e-07|34.0|141/100| SEG 105->121|avhepvrvvavvvtper| SEG 178->189|rfyrrrylrslr| RP:PFM:NREP 1 RP:PFM:REP 42->161|PF09348|1e-11|39.3|117/156|DUF1990| HM:PFM:NREP 1 HM:PFM:REP 23->188|PF09348|1.4e-50|45.9|157/158|DUF1990| OP:NHOMO 21 OP:NHOMOORG 20 OP:PATTERN -------------------------------------------------------------------- -----------1--1--11-1-----------1111--11------1--11--12--1---------111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-13, 192-194| PSIPRED ccccccccccccccccHHHHcccccccccccccccccccccccEEEEEEEEEcccHHHHHHHHHHHHccHHHHccccEEEEccccccEEcccEEEEEEEEEEEEEEEccEEEEEEEEcccEEEEEEEEcccccccccEEEEEEEccccEEEEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //