[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68798.1
DDBJ      :             hypothetical protein
Swiss-Prot:Y1088_STRAW  RecName: Full=UPF0337 protein SAV_1088;

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.60.11
:57 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  2->58 1rykA_ a.60.11.1 * 0.00011 28.1 %
:HMM:PFM   6->57 PF05532 * CsbD 4.5e-17 46.2 52/53  
:BLT:SWISS 1->57 Y1088_STRAW 8e-15 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68798.1 GT:GENE BAC68798.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1375979..1376152) GB:FROM 1375979 GB:TO 1376152 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF05532: CsbD-like GB:PROTEIN_ID BAC68798.1 LENGTH 57 SQ:AASEQ MAGDQKAKAKMEQAKGKAKAAAGRAVGNERMAAEGQAEKSKGDARQAKEKTKDVFKH GT:EXON 1|1-57:0| SW:ID Y1088_STRAW SW:DE RecName: Full=UPF0337 protein SAV_1088; SW:GN OrderedLocusNames=SAV_1088; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->57|Y1088_STRAW|8e-15|100.0|57/57| SEG 6->25|kakakmeqakgkakaaagra| HM:PFM:NREP 1 HM:PFM:REP 6->57|PF05532|4.5e-17|46.2|52/53|CsbD| HM:SCP:REP 2->58|1rykA_|0.00011|28.1|57/69|a.60.11.1|1/1|Hypothetical protein YjbJ| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-57| PSIPRED ccccHHHHHHHHHHHcHHHHHHHHHHccHHHHHcccHHHHccHHHHHHHHHHHHccc //