[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68799.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.41.1
:110 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   19->98 3bl4B PDBj 9e-10 19.7 %
:HMM:SCOP  14->98 1eysH1 b.41.1.1 * 6.6e-08 36.2 %
:HMM:PFM   53->91 PF09679 * TraQ 0.00096 34.2 38/93  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68799.1 GT:GENE BAC68799.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1376258..1376590) GB:FROM 1376258 GB:TO 1376590 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68799.1 LENGTH 110 SQ:AASEQ MSDNISSFVPTAGHTPDADLAGYRVEAADGRVGKVDKQSRLVDSQYVLVDTGVWIFGRKVMLPAAGITGVDHEEKKIVVARTKAEIKGSPEFDEGKHLGDPAHRDQLDGH GT:EXON 1|1-110:0| RP:PDB:NREP 1 RP:PDB:REP 19->98|3bl4B|9e-10|19.7|76/109| HM:PFM:NREP 1 HM:PFM:REP 53->91|PF09679|0.00096|34.2|38/93|TraQ| HM:SCP:REP 14->98|1eysH1|6.6e-08|36.2|80/201|b.41.1.1|1/1|PRC-barrel domain| OP:NHOMO 11 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------11--2--4-2--------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 76 STR:RPRED 69.1 SQ:SECSTR ##################ccccccccHHHHHHHHHTccccEEE##cccHHHH##HHHHHHHHcccccccEEEEcccGGGHHHHHHHHHHTTccccEEE############ DISOP:02AL 1-3, 104-110| PSIPRED ccccccEEcccccccccccEEccEEEEcccccEEEEccEEccccEEEEEEccccccccEEEEcccccccccccccEEEEEccHHHHHccccccccccccccccccccccc //