[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68800.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:66 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   3->64 PF00146 * NADHdh 5.2e-05 35.5 62/311  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68800.1 GT:GENE BAC68800.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1376875..1377075) GB:FROM 1376875 GB:TO 1377075 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68800.1 LENGTH 66 SQ:AASEQ MPPTRGDAMLGIVAAVLFFIAFLINAADIATNDVFTSTNFMLIGLALLSLHVAGIGSGWASRSRRR GT:EXON 1|1-66:0| TM:NTM 2 TM:REGION 9->31| TM:REGION 35->57| HM:PFM:NREP 1 HM:PFM:REP 3->64|PF00146|5.2e-05|35.5|62/311|NADHdh| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 61-66| PSIPRED ccccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccccccccccc //