[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68801.1
DDBJ      :             putative anti-sigma factor antagonist
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  54/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.13.2
:125 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->101 1thnB PDBj 2e-13 36.6 %
:RPS:PDB   9->122 1auzA PDBj 2e-15 29.8 %
:RPS:SCOP  8->116 1th8B  c.13.2.1 * 6e-15 33.3 %
:HMM:SCOP  8->116 1h4xA_ c.13.2.1 * 2.9e-23 38.0 %
:RPS:PFM   47->100 PF01740 * STAS 8e-05 37.0 %
:HMM:PFM   22->109 PF01740 * STAS 7.1e-16 31.8 88/117  
:BLT:SWISS 8->121 SP2AA_BACCO 4e-12 33.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68801.1 GT:GENE BAC68801.1 GT:PRODUCT putative anti-sigma factor antagonist GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1377301..1377678 GB:FROM 1377301 GB:TO 1377678 GB:DIRECTION + GB:PRODUCT putative anti-sigma factor antagonist GB:NOTE PF01740: STAS domain GB:PROTEIN_ID BAC68801.1 LENGTH 125 SQ:AASEQ MSTEQAPLSIDVTLPREDVALVTVKGFLDVDTGTELHHHLANQMHHGRRHLLLDLSAVPFMDSSGINIILKAYKETRRVEGSVRLIDPAPAVQRILDLTGVSLTVPSAKSLDEALAETGDATDRQ GT:EXON 1|1-125:0| BL:SWS:NREP 1 BL:SWS:REP 8->121|SP2AA_BACCO|4e-12|33.6|113/116| BL:PDB:NREP 1 BL:PDB:REP 8->101|1thnB|2e-13|36.6|93/114| RP:PDB:NREP 1 RP:PDB:REP 9->122|1auzA|2e-15|29.8|114/116| RP:PFM:NREP 1 RP:PFM:REP 47->100|PF01740|8e-05|37.0|54/107|STAS| HM:PFM:NREP 1 HM:PFM:REP 22->109|PF01740|7.1e-16|31.8|88/117|STAS| RP:SCP:NREP 1 RP:SCP:REP 8->116|1th8B|6e-15|33.3|108/115|c.13.2.1| HM:SCP:REP 8->116|1h4xA_|2.9e-23|38.0|108/111|c.13.2.1|1/1|Anti-sigma factor antagonist SpoIIaa| OP:NHOMO 60 OP:NHOMOORG 55 OP:PATTERN ----------------------------------------------1--------------------- ----------------------------------------111------------------------3222---------------------------------------------------------------------1------------1---------------------------------------1111111111111111-11111111111---------------------------------------------------------------------------------------------------------1-1111111-1---11-111--1----------1-----1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 115 STR:RPRED 92.0 SQ:SECSTR #######EcccccEEETTEEEEcccccccTTHHHHHHHHHHHHHcccccEEEEEccccccccTTHHHHHHHHHHHHHHHTccccEEcccTTTTHHHHHHccGGGTcccccGGGTGGGTcccc### DISOP:02AL 1-5, 121-125| PSIPRED ccccccccEEEEEEccccEEEEEEcccEEHHHHHHHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHccccEEEccccHHHHHHHHHHccccc //