[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68809.1
DDBJ      :             putative MarR-family transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  27/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:168 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   31->158 2nyxB PDBj 1e-14 34.9 %
:RPS:PDB   18->152 2a61A PDBj 2e-11 20.3 %
:RPS:SCOP  50->155 2ethA1  a.4.5.28 * 2e-14 22.6 %
:HMM:SCOP  18->156 1jgsA_ a.4.5.28 * 2.9e-20 26.9 %
:HMM:PFM   46->103 PF01047 * MarR 6.5e-15 37.9 58/59  
:BLT:SWISS 46->152 YFIV_BACSU 2e-07 23.4 %
:PROS 78->112|PS01117|HTH_MARR_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68809.1 GT:GENE BAC68809.1 GT:PRODUCT putative MarR-family transcriptional regulator GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1384489..1384995) GB:FROM 1384489 GB:TO 1384995 GB:DIRECTION - GB:PRODUCT putative MarR-family transcriptional regulator GB:NOTE PF01047: MarR family GB:PROTEIN_ID BAC68809.1 LENGTH 168 SQ:AASEQ MRDEREPSDAADAGRRPEAVARQVADAVENLVTLWTAAAEAVSPRLSAYQLKALRAVWHRSELNLTALADTLGIALPAASRLCDRLEAAGLLERMSHPRNRRELQLRVTPHGRRVLLEVAERRSRSLATVLAAMPPAQRTSLEHGLHAFHEARARPGAGGDRHRRAQE GT:EXON 1|1-168:0| BL:SWS:NREP 1 BL:SWS:REP 46->152|YFIV_BACSU|2e-07|23.4|107/160| PROS 78->112|PS01117|HTH_MARR_1|PDOC00861| BL:PDB:NREP 1 BL:PDB:REP 31->158|2nyxB|1e-14|34.9|126/145| RP:PDB:NREP 1 RP:PDB:REP 18->152|2a61A|2e-11|20.3|133/142| HM:PFM:NREP 1 HM:PFM:REP 46->103|PF01047|6.5e-15|37.9|58/59|MarR| RP:SCP:NREP 1 RP:SCP:REP 50->155|2ethA1|2e-14|22.6|106/140|a.4.5.28| HM:SCP:REP 18->156|1jgsA_|2.9e-20|26.9|134/0|a.4.5.28|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 32 OP:NHOMOORG 27 OP:PATTERN -------------------------------------------------------------------- ----2---------11111-1-111-111111-111--1---1-------------------1----223--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 158 STR:RPRED 94.0 SQ:SECSTR ########cccTTcccHHHHHHHHHHHHHHHHHHHHTTHHHHTGGccHHHHHHHHHHHHHccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEEEETTEEEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHcEEcccTTcccT## DISOP:02AL 1-16, 151-168| PSIPRED ccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccccHHHHHHHHccccHHHHHHHHHHHHcccEEcccccccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccccccccccc //