[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68810.1
DDBJ      :             putative regulatory protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.122.1
:144 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   33->133 3ehjA PDBj 8e-06 13.5 %
:HMM:SCOP  19->144 1l0oA_ d.122.1.3 * 1.1e-07 23.4 %
:HMM:PFM   58->132 PF02518 * HATPase_c 9.4e-06 22.7 75/111  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68810.1 GT:GENE BAC68810.1 GT:PRODUCT putative regulatory protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1385447..1385881 GB:FROM 1385447 GB:TO 1385881 GB:DIRECTION + GB:PRODUCT putative regulatory protein GB:NOTE PF02518: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase GB:PROTEIN_ID BAC68810.1 LENGTH 144 SQ:AASEQ MSTKPRRESPLPTEDVRSLTAAFDGDLRNVTDARLAAEGFLRTLARASPPTSPECEHDVLLVVNELAANAVQYAPGPFTLRMRTTFDGVHVTLRDTSTTRPAPRPFHPSRGGGGIGWHLVQSLCTQVSVVVHPEGKDIHVFLPW GT:EXON 1|1-144:0| RP:PDB:NREP 1 RP:PDB:REP 33->133|3ehjA|8e-06|13.5|96/196| HM:PFM:NREP 1 HM:PFM:REP 58->132|PF02518|9.4e-06|22.7|75/111|HATPase_c| HM:SCP:REP 19->144|1l0oA_|1.1e-07|23.4|124/141|d.122.1.3|1/1|ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase| OP:NHOMO 5 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------311----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 96 STR:RPRED 66.7 SQ:SECSTR ################################HHHHHTTcEEcccccccccccHHHHHHHHHHHHHHHHHHHHTcccEEEEEEEcccEEEEEEEEccccccc#####TTcccHHHHHHHHHHTTcEEEEEccc########### DISOP:02AL 1-4, 8-9| PSIPRED cccccccccccccccccccEEEcccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHEEEccccEEEEEEEEccEEEEEEEEcccccccccccccccccccHHHHHHHHHHHHcccEEccccEEEEEEEcc //